Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4634
Gene name
LocationContig_431:5919..6429
Strand-
Gene length (bp)510
Transcript length (bp)510
Coding sequence length (bp)510
Protein length (aa) 170

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00188 CAP Cysteine-rich secretory protein family 3.3E-10 40 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 49 162 9.0E-31
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 51 162 1.0E-29
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 6 162 6.0E-28
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 31 156 1.0E-25
sp|P35792|PR12_HORVU Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1 36 157 3.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 49 162 9.0E-31
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 51 162 1.0E-29
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 6 162 6.0E-28
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 31 156 1.0E-25
sp|P35792|PR12_HORVU Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1 36 157 3.0E-23
sp|Q05968|PR1_HORVU Pathogenesis-related protein 1 OS=Hordeum vulgare PE=2 SV=1 36 157 4.0E-23
sp|P35793|PR13_HORVU Pathogenesis-related protein PRB1-3 OS=Hordeum vulgare PE=2 SV=1 3 157 1.0E-22
sp|Q59PV6|PRY1_CANAL Secreted protein PRY1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRY1 PE=1 SV=1 28 162 1.0E-21
sp|Q00008|PRMS_MAIZE Pathogenesis-related protein PRMS OS=Zea mays GN=PRMS PE=2 SV=1 2 156 2.0E-19
sp|Q40374|PR1_MEDTR Pathogenesis-related protein PR-1 OS=Medicago truncatula GN=PR-1 PE=2 SV=1 12 157 3.0E-19
sp|Q59WG5|Y2336_CANAL Probable pathogenesis-related protein CaO19.2336 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.2336 PE=2 SV=1 30 162 7.0E-18
sp|P33154|PR1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=At2g14610 PE=1 SV=1 9 157 9.0E-18
sp|Q5AB49|Y6200_CANAL Probable pathogenesis-related protein CaO19.6200 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.13580 PE=2 SV=1 30 162 9.0E-18
sp|Q9ZNS4|PRB1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=PRB1 PE=2 SV=1 26 157 1.0E-16
sp|Q08697|PR1A_SOLLC Pathogenesis-related protein 1A1 OS=Solanum lycopersicum PE=2 SV=1 43 160 6.0E-16
sp|P07053|PR1B_TOBAC Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1 43 157 5.0E-15
sp|P11670|PRB1_TOBAC Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1 43 157 8.0E-15
sp|P09042|PR1C_TOBAC Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3 43 157 2.0E-14
sp|Q5AB48|RBT4_CANAL Secreted protein RBT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBT4 PE=1 SV=2 22 156 2.0E-13
sp|Q41359|PR1_SAMNI Pathogenesis-related protein PR-1 type OS=Sambucus nigra PE=2 SV=1 43 157 2.0E-13
sp|P08299|PR1A_TOBAC Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1 29 157 4.0E-13
sp|Q41495|ST14_SOLTU STS14 protein OS=Solanum tuberosum GN=STS14 PE=2 SV=1 43 157 6.0E-11
sp|Q9CYL5|GAPR1_MOUSE Golgi-associated plant pathogenesis-related protein 1 OS=Mus musculus GN=Glipr2 PE=1 SV=3 29 167 1.0E-10
sp|Q04108|PR04_SOLLC Pathogenesis-related leaf protein 4 OS=Solanum lycopersicum PE=2 SV=1 5 157 2.0E-10
sp|P04284|PR06_SOLLC Pathogenesis-related leaf protein 6 OS=Solanum lycopersicum GN=PR1B1 PE=1 SV=2 5 157 5.0E-10
sp|Q9H4G4|GAPR1_HUMAN Golgi-associated plant pathogenesis-related protein 1 OS=Homo sapiens GN=GLIPR2 PE=1 SV=3 29 167 1.0E-09
sp|Q6UWM5|GPRL1_HUMAN GLIPR1-like protein 1 OS=Homo sapiens GN=GLIPR1L1 PE=1 SV=2 7 153 1.0E-09
sp|D4B327|PRY1_ARTBC Probable pathogenesis-related protein ARB_02861 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02861 PE=3 SV=2 42 165 2.0E-09
sp|Q3SB05|CRVP_PSETE Cysteine-rich venom protein pseudechetoxin-like OS=Pseudonaja textilis PE=1 SV=1 51 169 6.0E-09
sp|Q3SB06|CRVP_OXYMI Cysteine-rich venom protein pseudechetoxin-like OS=Oxyuranus microlepidotus PE=2 SV=1 5 169 7.0E-09
sp|B3A0P7|SCP1_LOTGI SCP domain-containing protein 1 OS=Lottia gigantea PE=1 SV=1 18 158 9.0E-09
sp|Q3SB07|CRVP_OXYSC Cysteine-rich venom protein pseudechetoxin-like OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 51 169 1.0E-08
sp|P35794|SC7_SCHCO Fruiting body protein SC7 OS=Schizophyllum commune GN=SC7 PE=2 SV=1 9 154 1.0E-08
sp|P35795|SC14_SCHCO Fruiting body protein SC14 OS=Schizophyllum commune GN=SC14 PE=2 SV=1 36 155 8.0E-08
sp|P35778|VA3_SOLIN Venom allergen 3 OS=Solenopsis invicta PE=1 SV=2 51 156 1.0E-07
sp|Q7T141|PI15A_DANRE Peptidase inhibitor 15-A OS=Danio rerio GN=pi15a PE=3 SV=2 50 165 1.0E-07
sp|Q4V9Y5|CRLD2_XENTR Cysteine-rich secretory protein LCCL domain-containing 2 OS=Xenopus tropicalis GN=crispld2 PE=2 SV=1 79 165 1.0E-07
sp|Q7ZT99|CRVP_CROAT Cysteine-rich venom protein catrin OS=Crotalus atrox PE=1 SV=1 68 157 2.0E-07
sp|Q7ZTA0|CRVP_AGKPI Cysteine-rich venom protein piscivorin OS=Agkistrodon piscivorus piscivorus PE=1 SV=1 94 169 3.0E-07
sp|P16562|CRIS2_HUMAN Cysteine-rich secretory protein 2 OS=Homo sapiens GN=CRISP2 PE=1 SV=1 70 157 3.0E-07
sp|P35759|VA5_POLEX Venom allergen 5 OS=Polistes exclamans PE=1 SV=2 51 158 3.0E-07
sp|F8S0Y4|CRVP_CROAD Cysteine-rich secretory protein OS=Crotalus adamanteus PE=1 SV=1 94 157 3.0E-07
sp|Q6UXB8|PI16_HUMAN Peptidase inhibitor 16 OS=Homo sapiens GN=PI16 PE=1 SV=1 51 165 4.0E-07
sp|P54108|CRIS3_HUMAN Cysteine-rich secretory protein 3 OS=Homo sapiens GN=CRISP3 PE=1 SV=1 5 153 4.0E-07
sp|P60623|CRVP_TRIST Cysteine-rich venom protein (Fragment) OS=Trimeresurus stejnegeri PE=1 SV=1 94 157 4.0E-07
sp|Q05108|VA5_DOLAR Venom allergen 5 OS=Dolichovespula arenaria PE=1 SV=1 50 157 5.0E-07
sp|Q9H0B8|CRLD2_HUMAN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Homo sapiens GN=CRISPLD2 PE=2 SV=1 87 165 6.0E-07
sp|Q8BZQ2|CRLD2_MOUSE Cysteine-rich secretory protein LCCL domain-containing 2 OS=Mus musculus GN=Crispld2 PE=1 SV=1 79 165 9.0E-07
sp|Q8JGT9|CRVP_RHATT Cysteine-rich venom protein tigrin OS=Rhabdophis tigrinus tigrinus PE=1 SV=1 68 156 1.0E-06
sp|Q8JI38|CRVP_LATSE Cysteine-rich venom protein latisemin OS=Laticauda semifasciata PE=2 SV=1 53 169 1.0E-06
sp|Q09GJ9|CRVP_PHIOL Cysteine-rich venom protein OS=Philodryas olfersii PE=2 SV=1 70 157 2.0E-06
sp|Q98ST6|PI15_CHICK Peptidase inhibitor 15 OS=Gallus gallus GN=PI15 PE=2 SV=1 50 165 2.0E-06
sp|F7C0L1|CRISA_XENTR Allurin OS=Xenopus tropicalis GN=crisp-a PE=1 SV=2 70 159 2.0E-06
sp|Q58D34|PI16_BOVIN Peptidase inhibitor 16 OS=Bos taurus GN=PI16 PE=2 SV=1 51 165 2.0E-06
sp|Q7ZT98|CRVP_OPHHA Cysteine-rich venom protein ophanin OS=Ophiophagus hannah PE=1 SV=1 69 156 2.0E-06
sp|Q9ET66|PI16_MOUSE Peptidase inhibitor 16 OS=Mus musculus GN=Pi16 PE=2 SV=1 51 165 2.0E-06
sp|P16563|CRIS2_MOUSE Cysteine-rich secretory protein 2 OS=Mus musculus GN=Crisp2 PE=1 SV=1 6 153 2.0E-06
sp|Q05109|VA5_POLAN Venom allergen 5 (Fragment) OS=Polistes annularis PE=1 SV=1 51 158 2.0E-06
sp|Q3KPV7|PI15_XENLA Peptidase inhibitor 15 OS=Xenopus laevis GN=pi15 PE=2 SV=1 50 165 3.0E-06
sp|A6QLZ7|CRLD2_BOVIN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Bos taurus GN=CRISPLD2 PE=2 SV=1 29 165 3.0E-06
sp|P79845|CRVP_PROMU Cysteine-rich venom protein OS=Protobothrops mucrosquamatus PE=2 SV=2 68 157 3.0E-06
sp|P0DMT4|CRVP_ECHCO Cysteine-rich venom protein OS=Echis coloratus PE=1 SV=1 68 157 3.0E-06
sp|P35780|VA5_POLFU Venom allergen 5 OS=Polistes fuscatus PE=1 SV=1 79 158 3.0E-06
sp|O19010|CRIS3_HORSE Cysteine-rich secretory protein 3 OS=Equus caballus GN=CRISP3 PE=1 SV=1 51 158 4.0E-06
sp|Q2XXP2|CRVPA_VARVA Cysteine-rich venom protein VAR10 (Fragment) OS=Varanus varius PE=2 SV=1 49 157 4.0E-06
sp|Q2XXP1|CRVPB_VARVA Cysteine-rich venom protein VAR11 OS=Varanus varius PE=2 SV=1 49 157 5.0E-06
sp|Q09566|LON1_CAEEL Protein lon-1 OS=Caenorhabditis elegans GN=lon-1 PE=1 SV=1 50 155 5.0E-06
sp|P35779|VA3_SOLRI Venom allergen 3 OS=Solenopsis richteri PE=1 SV=2 51 156 7.0E-06
sp|Q2XXQ1|CRVP_LEIMD Cysteine-rich venom protein LEI1 (Fragment) OS=Leioheterodon madagascariensis PE=1 SV=1 68 158 9.0E-06
sp|Q7ZZN9|CRVP_PROJR Cysteine-rich venom protein OS=Protobothrops jerdonii PE=1 SV=1 94 157 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4634
MKKPLVLLALAMSAASADSDPNFWWLDEQAFQSAVISTTSHYRGEYGAGFIMWNATLAAFASWYLNNYNCAFQHS
GGPFGENMAFGYQTPAVSVAAWGNEAVEYDYGHPGYSPATGHFTQLVWKATTDVGCARRWCGSQMQWLFACEYWP
RGNVLGQFEQNVGWPGRSG*
Coding >Ophun1|4634
ATGAAGAAGCCGCTCGTCCTCCTCGCCCTGGCCATGTCCGCCGCCAGCGCAGACTCCGACCCCAACTTCTGGTGG
CTGGACGAGCAAGCCTTCCAGTCAGCCGTCATCAGCACGACAAGCCACTACCGCGGCGAGTACGGCGCGGGCTTC
ATCATGTGGAACGCGACGCTGGCCGCCTTCGCATCGTGGTACCTCAACAACTACAACTGCGCCTTTCAGCACTCG
GGCGGTCCCTTTGGCGAGAACATGGCCTTTGGCTACCAGACGCCCGCCGTCAGCGTCGCCGCCTGGGGCAACGAG
GCCGTTGAGTACGACTACGGCCATCCCGGCTATAGTCCTGCTACGGGCCACTTTACGCAGCTGGTTTGGAAGGCG
ACGACGGATGTGGGCTGTGCCAGGAGGTGGTGCGGTAGCCAGATGCAGTGGCTTTTTGCGTGTGAGTATTGGCCG
AGAGGGAATGTTCTGGGTCAGTTTGAGCAGAATGTTGGGTGGCCTGGACGGAGCGGGTGA
Transcript >Ophun1|4634
ATGAAGAAGCCGCTCGTCCTCCTCGCCCTGGCCATGTCCGCCGCCAGCGCAGACTCCGACCCCAACTTCTGGTGG
CTGGACGAGCAAGCCTTCCAGTCAGCCGTCATCAGCACGACAAGCCACTACCGCGGCGAGTACGGCGCGGGCTTC
ATCATGTGGAACGCGACGCTGGCCGCCTTCGCATCGTGGTACCTCAACAACTACAACTGCGCCTTTCAGCACTCG
GGCGGTCCCTTTGGCGAGAACATGGCCTTTGGCTACCAGACGCCCGCCGTCAGCGTCGCCGCCTGGGGCAACGAG
GCCGTTGAGTACGACTACGGCCATCCCGGCTATAGTCCTGCTACGGGCCACTTTACGCAGCTGGTTTGGAAGGCG
ACGACGGATGTGGGCTGTGCCAGGAGGTGGTGCGGTAGCCAGATGCAGTGGCTTTTTGCGTGTGAGTATTGGCCG
AGAGGGAATGTTCTGGGTCAGTTTGAGCAGAATGTTGGGTGGCCTGGACGGAGCGGGTGA
Gene >Ophun1|4634
ATGAAGAAGCCGCTCGTCCTCCTCGCCCTGGCCATGTCCGCCGCCAGCGCAGACTCCGACCCCAACTTCTGGTGG
CTGGACGAGCAAGCCTTCCAGTCAGCCGTCATCAGCACGACAAGCCACTACCGCGGCGAGTACGGCGCGGGCTTC
ATCATGTGGAACGCGACGCTGGCCGCCTTCGCATCGTGGTACCTCAACAACTACAACTGCGCCTTTCAGCACTCG
GGCGGTCCCTTTGGCGAGAACATGGCCTTTGGCTACCAGACGCCCGCCGTCAGCGTCGCCGCCTGGGGCAACGAG
GCCGTTGAGTACGACTACGGCCATCCCGGCTATAGTCCTGCTACGGGCCACTTTACGCAGCTGGTTTGGAAGGCG
ACGACGGATGTGGGCTGTGCCAGGAGGTGGTGCGGTAGCCAGATGCAGTGGCTTTTTGCGTGTGAGTATTGGCCG
AGAGGGAATGTTCTGGGTCAGTTTGAGCAGAATGTTGGGTGGCCTGGACGGAGCGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail