Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4632
Gene name
LocationContig_431:85..2647
Strand-
Gene length (bp)2562
Transcript length (bp)2460
Coding sequence length (bp)2460
Protein length (aa) 820

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08619 Nha1_C Alkali metal cation/H+ antiporter Nha1 C terminus 2.5E-87 458 811
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 2.3E-78 16 433

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14123|NAH2_SCHPO Probable Na(+)/H(+) antiporter C3A11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod22 PE=1 SV=1 1 695 0.0E+00
sp|Q99173|NAH1_ZYGRO Na(+)/H(+) antiporter 1 OS=Zygosaccharomyces rouxii GN=SOD2 PE=3 SV=1 1 719 0.0E+00
sp|O42701|NAH2_ZYGRO Na(+)/H(+) antiporter 2 OS=Zygosaccharomyces rouxii GN=SOD22 PE=3 SV=1 1 719 0.0E+00
sp|Q99271|NAH1_YEAST Na(+)/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHA1 PE=1 SV=1 3 471 0.0E+00
sp|P36606|NAH_SCHPO Na(+)/H(+) antiporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod2 PE=1 SV=1 1 454 3.0E-124

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0006812 cation transport Yes
GO:0015385 sodium:proton antiporter activity Yes
GO:0006814 sodium ion transport Yes
GO:0051234 establishment of localization No
GO:0008324 cation transmembrane transporter activity No
GO:0005451 monovalent cation:proton antiporter activity No
GO:0006811 ion transport No
GO:0022804 active transmembrane transporter activity No
GO:0015291 secondary active transmembrane transporter activity No
GO:0015491 cation:cation antiporter activity No
GO:0009987 cellular process No
GO:0015297 antiporter activity No
GO:0006810 transport No
GO:0015298 solute:cation antiporter activity No
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No
GO:0022857 transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0022853 active ion transmembrane transporter activity No
GO:0051139 metal ion:proton antiporter activity No
GO:0015081 sodium ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0030001 metal ion transport No
GO:0015078 proton transmembrane transporter activity No
GO:0046873 metal ion transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 13 32 19
2 102 124 22
3 134 153 19
4 174 193 19
5 203 225 22
6 246 265 19
7 293 315 22
8 327 349 22
9 362 384 22
10 405 427 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4632
MAWSHLDITEPHLVYIILGGFTSLFMLCSSFIKERMYIGEATVATLCGVIFGPHAANLINPEKWGNTDIVTLEFS
RIVLVVQCFAVGVELPKFYMERHWRSVVFLLVPVMAFGWLMVSLFIYWMIPPLNWLDSLVVAACVTATDPVLASS
VVGKGKFAKRVPKHLRDLLSAESGCNDGMAFPFIYLSLYLIQYNKNAGKVSYYFIVYVILYECIFGAIFGFVIGY
IARHGIKYSEKHDLIDRESFLVFYFALALFCAGSGSILGLDDLLVGFTAGVGFSNDGWFGEKTEESHVSNVIDLL
LNLTYFVYFGTIIPWEQYNNGVFGLKAWRLVVIAVFVLLFRRIPIMLALKPLIPDIKNWREAFFAGHFGPVGVGA
IFVAILARAELEHHESVPLPMLPPEDSENYALIYLVWPIVTFLVISSILVHGSSVAVFTLGKRINTLTLTMSYTA
APDEATNWMNRLPRISSQSRSQAKTASDASFDDDKDPELPPGALMPPLGFLRRQRDDDNIPSRSGSRASSLVSKR
RKHSSRRWDDGIGPGGPVSQSAIFPSRPMPGTGSGGVVLQETLSSPARENTDSTLSGGSAKVKDPEKREDGDNGE
GGQRHGERAPRVQVYAEGDHVVVEDESGDVLDVHSAHQQSEEVSNAEEEDAGGDAGEEASIWTLHGFRRKMSDMY
TSEMEKRKGKANAQRRHEPARAYQFGSMIIVEDEDGEVVKSYQLPSQRDQGGEPSNDLIGASLKYLGLGAKNRQG
EKSAEEAAEEGKAGVRASTTPAGRPSGWPGFGRSVAQRRTFAQQQEADDDKKIRFTIGGSGCPDAQGGG*
Coding >Ophun1|4632
ATGGCCTGGTCTCACCTCGACATCACCGAGCCCCACCTCGTCTACATCATCCTCGGAGGCTTCACCTCCCTCTTC
ATGCTATGCTCCTCCTTCATCAAGGAGCGCATGTACATTGGTGAAGCCACCGTCGCCACTCTCTGCGGCGTCATC
TTCGGCCCCCACGCCGCCAACCTCATCAACCCGGAGAAATGGGGCAACACCGACATCGTCACCCTCGAATTCTCC
CGCATCGTCCTCGTCGTCCAATGCTTCGCCGTCGGCGTCGAATTGCCCAAATTCTACATGGAGAGGCATTGGCGC
TCCGTCGTCTTCCTCCTCGTCCCCGTCATGGCCTTTGGATGGCTCATGGTCAGCCTCTTCATCTACTGGATGATT
CCTCCCCTCAATTGGCTCGATTCCCTCGTCGTCGCCGCCTGTGTCACCGCCACCGATCCCGTCCTCGCATCCTCC
GTCGTCGGAAAGGGCAAGTTTGCCAAGCGCGTCCCCAAGCATCTTCGCGACCTCCTCTCGGCCGAGTCCGGCTGC
AACGACGGTATGGCCTTTCCCTTCATCTACCTCTCCCTCTACCTGATTCAGTACAACAAAAACGCCGGCAAGGTC
AGCTACTACTTCATCGTCTACGTCATCCTGTACGAGTGCATCTTTGGTGCCATCTTTGGTTTCGTCATCGGCTAC
ATTGCCCGTCACGGCATCAAGTATTCCGAGAAGCACGACCTCATCGATCGTGAGAGCTTCCTCGTATTCTACTTT
GCCCTCGCCCTCTTCTGCGCCGGTTCCGGCAGTATTCTCGGCCTCGACGACCTCCTCGTCGGCTTCACCGCCGGT
GTCGGCTTCTCCAACGACGGCTGGTTCGGCGAAAAGACGGAGGAGTCACACGTGTCCAACGTCATCGACCTGTTG
CTCAACCTGACCTACTTTGTCTACTTTGGCACCATAATCCCGTGGGAGCAGTACAACAATGGCGTCTTTGGTCTC
AAGGCCTGGCGACTCGTCGTCATCGCCGTCTTCGTCCTGCTCTTCCGTCGCATCCCCATCATGCTGGCCCTCAAG
CCCCTGATACCGGATATAAAGAACTGGCGAGAAGCCTTCTTCGCCGGCCACTTTGGTCCCGTTGGCGTCGGCGCC
ATCTTCGTCGCTATTCTCGCCCGCGCCGAGCTCGAACACCACGAGTCGGTCCCGTTGCCGATGCTGCCACCCGAG
GATTCGGAGAATTATGCGCTCATCTACCTCGTCTGGCCCATCGTCACCTTTCTCGTCATCTCGTCCATCCTCGTC
CACGGCTCGTCCGTCGCCGTCTTTACGCTGGGGAAGCGCATCAACACGCTGACACTGACCATGTCGTACACGGCC
GCTCCGGACGAGGCCACCAACTGGATGAACCGGCTGCCGCGCATCTCGTCTCAGTCGCGCTCTCAGGCCAAGACG
GCTTCGGACGCCTCCTTTGACGACGACAAGGACCCCGAGCTGCCACCGGGCGCCCTGATGCCGCCTCTGGGCTTC
CTGCGCCGTCAGAGAGACGATGACAACATCCCGAGCCGCAGCGGCAGTCGGGCCTCTTCCCTCGTGTCCAAGAGG
CGCAAGCACAGCAGCAGGAGGTGGGACGACGGCATCGGTCCGGGCGGCCCCGTGAGCCAGTCGGCCATCTTCCCG
AGCCGGCCGATGCCCGGCACCGGTAGCGGCGGCGTTGTTCTTCAGGAGACGCTGTCGTCACCCGCGCGCGAAAAC
ACCGACTCGACGCTATCCGGGGGCAGCGCCAAGGTCAAGGATCCGGAGAAGCGGGAGGACGGCGACAACGGCGAG
GGAGGGCAGCGGCACGGCGAACGGGCACCTCGCGTGCAAGTCTACGCCGAGGGAGACCACGTCGTCGTGGAAGAC
GAGAGCGGCGACGTGCTGGACGTCCATTCGGCTCACCAGCAGAGTGAGGAGGTCTCCAACGCGGAAGAGGAGGAT
GCTGGCGGTGACGCGGGAGAGGAAGCCTCAATCTGGACGCTGCACGGGTTTCGACGTAAGATGAGCGACATGTAC
ACGTCGGAGATGGAGAAGCGCAAGGGCAAGGCCAATGCTCAGCGGCGACACGAGCCGGCGCGGGCCTATCAGTTT
GGCAGCATGATTATCGTCGAGGACGAAGACGGCGAGGTGGTCAAGTCATACCAGCTGCCTTCGCAGAGAGACCAA
GGGGGCGAACCGAGCAACGACCTCATCGGAGCCAGCCTCAAGTATCTCGGTCTCGGGGCCAAGAACCGCCAAGGC
GAAAAGAGCGCGGAAGAAGCGGCGGAAGAAGGGAAAGCCGGCGTGAGGGCCTCTACGACTCCCGCGGGCAGGCCG
TCTGGGTGGCCCGGGTTCGGCAGGTCGGTGGCGCAGAGGAGGACGTTTGCGCAGCAGCAGGAGGCCGACGACGAT
AAGAAGATTCGCTTCACCATCGGGGGATCTGGATGCCCGGACGCGCAGGGAGGTGGTTGA
Transcript >Ophun1|4632
ATGGCCTGGTCTCACCTCGACATCACCGAGCCCCACCTCGTCTACATCATCCTCGGAGGCTTCACCTCCCTCTTC
ATGCTATGCTCCTCCTTCATCAAGGAGCGCATGTACATTGGTGAAGCCACCGTCGCCACTCTCTGCGGCGTCATC
TTCGGCCCCCACGCCGCCAACCTCATCAACCCGGAGAAATGGGGCAACACCGACATCGTCACCCTCGAATTCTCC
CGCATCGTCCTCGTCGTCCAATGCTTCGCCGTCGGCGTCGAATTGCCCAAATTCTACATGGAGAGGCATTGGCGC
TCCGTCGTCTTCCTCCTCGTCCCCGTCATGGCCTTTGGATGGCTCATGGTCAGCCTCTTCATCTACTGGATGATT
CCTCCCCTCAATTGGCTCGATTCCCTCGTCGTCGCCGCCTGTGTCACCGCCACCGATCCCGTCCTCGCATCCTCC
GTCGTCGGAAAGGGCAAGTTTGCCAAGCGCGTCCCCAAGCATCTTCGCGACCTCCTCTCGGCCGAGTCCGGCTGC
AACGACGGTATGGCCTTTCCCTTCATCTACCTCTCCCTCTACCTGATTCAGTACAACAAAAACGCCGGCAAGGTC
AGCTACTACTTCATCGTCTACGTCATCCTGTACGAGTGCATCTTTGGTGCCATCTTTGGTTTCGTCATCGGCTAC
ATTGCCCGTCACGGCATCAAGTATTCCGAGAAGCACGACCTCATCGATCGTGAGAGCTTCCTCGTATTCTACTTT
GCCCTCGCCCTCTTCTGCGCCGGTTCCGGCAGTATTCTCGGCCTCGACGACCTCCTCGTCGGCTTCACCGCCGGT
GTCGGCTTCTCCAACGACGGCTGGTTCGGCGAAAAGACGGAGGAGTCACACGTGTCCAACGTCATCGACCTGTTG
CTCAACCTGACCTACTTTGTCTACTTTGGCACCATAATCCCGTGGGAGCAGTACAACAATGGCGTCTTTGGTCTC
AAGGCCTGGCGACTCGTCGTCATCGCCGTCTTCGTCCTGCTCTTCCGTCGCATCCCCATCATGCTGGCCCTCAAG
CCCCTGATACCGGATATAAAGAACTGGCGAGAAGCCTTCTTCGCCGGCCACTTTGGTCCCGTTGGCGTCGGCGCC
ATCTTCGTCGCTATTCTCGCCCGCGCCGAGCTCGAACACCACGAGTCGGTCCCGTTGCCGATGCTGCCACCCGAG
GATTCGGAGAATTATGCGCTCATCTACCTCGTCTGGCCCATCGTCACCTTTCTCGTCATCTCGTCCATCCTCGTC
CACGGCTCGTCCGTCGCCGTCTTTACGCTGGGGAAGCGCATCAACACGCTGACACTGACCATGTCGTACACGGCC
GCTCCGGACGAGGCCACCAACTGGATGAACCGGCTGCCGCGCATCTCGTCTCAGTCGCGCTCTCAGGCCAAGACG
GCTTCGGACGCCTCCTTTGACGACGACAAGGACCCCGAGCTGCCACCGGGCGCCCTGATGCCGCCTCTGGGCTTC
CTGCGCCGTCAGAGAGACGATGACAACATCCCGAGCCGCAGCGGCAGTCGGGCCTCTTCCCTCGTGTCCAAGAGG
CGCAAGCACAGCAGCAGGAGGTGGGACGACGGCATCGGTCCGGGCGGCCCCGTGAGCCAGTCGGCCATCTTCCCG
AGCCGGCCGATGCCCGGCACCGGTAGCGGCGGCGTTGTTCTTCAGGAGACGCTGTCGTCACCCGCGCGCGAAAAC
ACCGACTCGACGCTATCCGGGGGCAGCGCCAAGGTCAAGGATCCGGAGAAGCGGGAGGACGGCGACAACGGCGAG
GGAGGGCAGCGGCACGGCGAACGGGCACCTCGCGTGCAAGTCTACGCCGAGGGAGACCACGTCGTCGTGGAAGAC
GAGAGCGGCGACGTGCTGGACGTCCATTCGGCTCACCAGCAGAGTGAGGAGGTCTCCAACGCGGAAGAGGAGGAT
GCTGGCGGTGACGCGGGAGAGGAAGCCTCAATCTGGACGCTGCACGGGTTTCGACGTAAGATGAGCGACATGTAC
ACGTCGGAGATGGAGAAGCGCAAGGGCAAGGCCAATGCTCAGCGGCGACACGAGCCGGCGCGGGCCTATCAGTTT
GGCAGCATGATTATCGTCGAGGACGAAGACGGCGAGGTGGTCAAGTCATACCAGCTGCCTTCGCAGAGAGACCAA
GGGGGCGAACCGAGCAACGACCTCATCGGAGCCAGCCTCAAGTATCTCGGTCTCGGGGCCAAGAACCGCCAAGGC
GAAAAGAGCGCGGAAGAAGCGGCGGAAGAAGGGAAAGCCGGCGTGAGGGCCTCTACGACTCCCGCGGGCAGGCCG
TCTGGGTGGCCCGGGTTCGGCAGGTCGGTGGCGCAGAGGAGGACGTTTGCGCAGCAGCAGGAGGCCGACGACGAT
AAGAAGATTCGCTTCACCATCGGGGGATCTGGATGCCCGGACGCGCAGGGAGGTGGTTGA
Gene >Ophun1|4632
ATGGCCTGGTCTCACCTCGACATCACCGAGCCCCACCTCGTCTACATCATCCTCGGAGGCTTCACCTCCCTCTTC
ATGCTATGCTCCTCCTTCATCAAGGAGCGCATGTACATTGGTGAAGCCACCGTCGCCACTCTCTGCGGCGTCATC
TTCGGCCCCCACGCCGCCAACCTCATCAACCCGGAGAAATGGGGCAACACCGACATCGTCACCCTCGAATTCTCC
CGCATCGTCCTCGTCGTCCAATGCTTCGCCGTCGGCGTCGAATTGCCCAAATTCTACATGGAGAGGCATTGGCGC
TCCGTCGTCTTCCTCCTCGTCCCCGTCATGGCCTTTGGATGGCTCATGGTCAGCCTCTTCATCTACTGGATGATT
CCTCCCCTCAATTGGCTCGATTCCCTCGTCGTCGCCGCCTGTGTCACCGCCACCGATCCCGTCCTCGCATCCTCC
GTCGTCGGAAAGGGCAAGTTTGCCAAGCGCGTCCCCAAGCATCTTCGCGACCTCCTCTCGGCCGAGTCCGGCTGC
AACGACGGTATGGCCTTTCCCTTCATCTACCTCTCCCTCTACCTGATTCAGTACAACAAAAACGCCGGCAAGGTC
AGCTACTACTTCATCGTCTACGTCATCCTGTACGAGTGCATCTTTGGTGCCATCTTTGGTTTCGTCATCGGCTAC
ATTGCCCGTCACGGCATCAAGTATTCCGAGAAGCACGACCTCATCGATCGTGAGAGCTTCCTCGTATTCTACTTT
GCCCTCGCCCTCTTCTGCGCCGGTTCCGGCAGTATTCTCGGCCTCGACGACCTCCTCGTCGGCTTCACCGCCGGT
GTCGGCTTCTCCAACGACGGCTGGTTCGGCGAAAAGACGGAGGAGTCACACGTGTCCAACGTCATCGACCTGTTG
CTCAACCTGACCTACTTTGTCTACTTTGGCACCATAATCCCGTGGGAGCAGTACAACAATGGCGTCTTTGGTCTC
AAGGCCTGGCGACTCGTCGTCATCGCCGTCTTCGTCCTGCTCTTCCGTCGCATCCCCATCATGCTGGCCCTCAAG
CCCCTGATACCGGATATAAAGAACTGGCGAGAAGCCTTCTTCGCCGGCCACTTTGGTCCCGTTGGCGTCGGCGCC
ATCTTCGTCGCTATTCTCGCCCGCGCCGAGCTCGAACACCACGAGTCGGTCCCGTTGCCGATGCTGCCACCCGAG
GATTCGGAGAATTATGCGCTCATCTACCTCGTCTGGCCCATCGTCACCTTTCTCGTCATCTCGTCCATCCTCGTC
CACGGCTCGTCCGTCGCCGTCTTTACGCTGGGGAAGCGCATCAACACGCTGACACTGACCATGTCGTACACGGCC
GCTCCGGACGAGGCCACCAACTGGATGAACCGGCTGCCGCGCATCTCGTCTCAGTCGCGCTCTCAGGCCAAGACG
GCTTCGGACGCCTCCTTTGACGACGACAAGGACCCCGAGCTGCCACCGGGCGCCCTGATGCCGCCTCTGGGCTTC
CTGCGCCGTCAGAGAGACGATGACAACATCCCGAGCCGCAGCGGCAGTCGGGCCTCTTCCCTCGTGTCCAAGAGG
CGCAAGCACAGCAGCAGGAGGTGGGACGACGGCATCGGTCCGGGCGGCCCCGTGAGCCAGTCGGCCATCTTCCCG
AGCCGGCCGATGCCCGGCACCGGTAGCGGCGGCGTTGTTCTTCAGGAGACGCTGTCGTCACCCGCGCGCGAAAAC
ACCGACTCGACGCTATCCGGGGGCAGCGCCAAGGTCAAGGATCCGGAGAAGCGGGAGGACGGCGACAACGGCGAG
GGAGGGCAGCGGCACGGCGAACGGGCACCTCGCGTGCAAGTCTACGCCGAGGGAGACCACGTCGTCGTGGAAGAC
GAGAGCGGCGACGTGCTGGACGTCCATTCGGCTCACCAGCAGAGTGAGGAGGTCTCCAACGCGGAAGAGGAGGAT
GCTGGCGGTGACGCGGGAGAGGAAGCCTCAATCTGGACGCTGCACGGGTTTCGACGTAAGATGAGCGACATGTAC
ACGTCGGAGATGGAGAAGCGCAAGGGCAAGGCCAATGCTCAGCGGCGACACGAGCCGGCGCGGGCCTATCAGTTT
GGCAGCATGGTGGGTTCCCTTGTCATCCCCTTGTTCTCTCCTCGGGCTGACTGGACATGTGCAGATTATCGTCGA
GGACGAAGACGGCGAGGTGGTCAAGTCATACCAGCTGCCTTCGCAGAGAGACCAAGGGGGCGAACCGAGCAACGA
CCTCATCGGAGCCAGCCTCAAGTATCTCGGTCTCGGGGCCAAGAACCGCCAAGGCGAAAAGAGCGCGGAAGAAGC
GGCGGAAGAAGGGAAAGCCGGCGTGAGGGCCTCTACGACTCCCGCGGGCAGGCCGTCTGGGTGGCCCGGGTTCGG
CAGGTCGGTGGCGCAGAGGAGGACGTTTGCGCAGCAGCAGGAGGCCGACGACGATAAGAAGATTCGCTTCACCAT
CGGGGGTGTGGGACGGCGGATGACCAAGGATGACTTTATCCGCCAGGTGCAGGATCTGGATGCCCGGACGCGCAG
GGAGGTGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail