Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4630
Gene name
LocationContig_430:12956..14175
Strand+
Gene length (bp)1219
Transcript length (bp)1089
Coding sequence length (bp)1089
Protein length (aa) 363

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00615 RGS Regulator of G protein signaling domain 8.8E-08 170 239

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7S8|RAX1_SCHPO Protein rax1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rax1 PE=3 SV=1 22 362 2.0E-50
sp|Q08760|RAX1_YEAST Bud site selection protein RAX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAX1 PE=1 SV=1 16 362 5.0E-34

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 252 274 22
2 281 303 22
3 336 358 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4630
MSTKMAPASPSPQPDLSRNRLPTLFEVLSRRTLPPVDLFSFYIYMRDQQRSVDYLDFWLDVAQHMSLCRHYVREL
RRSVLVATPDVDKAGSKRSSGILESLGDLEPRTAGPSMYTSEKERDQDAQMSAFLREDLPHDSAHSGSGVIRPSP
QFSTPRDVTDSNSPAHTVARQDIRASAEKILYTFLLPGAEREITLPGSITQDVTIAIEDHGRDDPEVFDVAKDYV
FQAMERDAFPGFLRMKALGNLIPPTLVMRLIIGLVSMFAAFWAGFVLIFLDSWRTTRCWLILPFTVGVYFLASYQ
YSLDPIMALVGFSEYTPFNFSRIREPYVRQLLAKRALMVLAVTLLVDAALCLLFILVPGKRL*
Coding >Ophun1|4630
ATGTCCACCAAGATGGCACCGGCCAGTCCCTCGCCGCAGCCAGACCTCTCGCGCAACAGACTTCCAACCCTCTTC
GAGGTGCTGAGTCGGCGCACGCTTCCGCCTGTCGATCTCTTCTCCTTTTATATCTATATGCGCGACCAGCAGCGC
TCCGTCGACTACCTCGACTTCTGGCTGGACGTGGCCCAACACATGTCGCTGTGCCGTCATTATGTGCGCGAGCTC
CGCCGATCTGTCCTTGTCGCCACGCCCGACGTCGACAAGGCTGGCTCCAAGAGATCGTCGGGCATCCTCGAGAGC
CTGGGCGACCTCGAGCCTCGCACGGCCGGCCCCTCCATGTACACGTCGGAGAAAGAGAGGGATCAAGATGCGCAG
ATGTCGGCCTTTTTGCGAGAGGACCTGCCTCACGACTCGGCTCACAGCGGCTCCGGCGTCATTCGCCCCAGCCCG
CAGTTCAGCACCCCTCGCGACGTAACCGACTCCAACTCGCCCGCCCACACCGTCGCCCGCCAGGATATCCGCGCC
TCGGCTGAGAAGATCCTCTACACTTTCCTGCTACCCGGTGCAGAGCGGGAGATTACGCTGCCCGGTTCCATCACG
CAGGACGTCACCATCGCCATCGAGGATCATGGCCGCGACGACCCAGAGGTCTTTGACGTCGCCAAGGACTACGTC
TTCCAGGCCATGGAGCGAGACGCCTTCCCGGGCTTCCTGCGCATGAAGGCCCTGGGTAATCTGATTCCGCCAACC
CTCGTGATGCGCCTCATCATCGGCCTCGTCTCCATGTTCGCCGCCTTCTGGGCCGGTTTCGTCCTCATCTTTCTC
GACAGCTGGCGCACCACCAGATGCTGGCTCATCCTGCCCTTCACCGTGGGCGTCTACTTCCTCGCCTCATACCAA
TACTCCCTCGACCCCATCATGGCCCTTGTTGGCTTCAGCGAGTACACGCCCTTTAACTTCTCGCGCATCAGGGAG
CCCTACGTCCGCCAACTCCTCGCCAAGCGTGCCCTCATGGTTCTCGCCGTTACGTTGCTCGTTGATGCTGCGCTG
TGCCTGCTCTTCATCCTCGTGCCTGGCAAGAGGCTGTGA
Transcript >Ophun1|4630
ATGTCCACCAAGATGGCACCGGCCAGTCCCTCGCCGCAGCCAGACCTCTCGCGCAACAGACTTCCAACCCTCTTC
GAGGTGCTGAGTCGGCGCACGCTTCCGCCTGTCGATCTCTTCTCCTTTTATATCTATATGCGCGACCAGCAGCGC
TCCGTCGACTACCTCGACTTCTGGCTGGACGTGGCCCAACACATGTCGCTGTGCCGTCATTATGTGCGCGAGCTC
CGCCGATCTGTCCTTGTCGCCACGCCCGACGTCGACAAGGCTGGCTCCAAGAGATCGTCGGGCATCCTCGAGAGC
CTGGGCGACCTCGAGCCTCGCACGGCCGGCCCCTCCATGTACACGTCGGAGAAAGAGAGGGATCAAGATGCGCAG
ATGTCGGCCTTTTTGCGAGAGGACCTGCCTCACGACTCGGCTCACAGCGGCTCCGGCGTCATTCGCCCCAGCCCG
CAGTTCAGCACCCCTCGCGACGTAACCGACTCCAACTCGCCCGCCCACACCGTCGCCCGCCAGGATATCCGCGCC
TCGGCTGAGAAGATCCTCTACACTTTCCTGCTACCCGGTGCAGAGCGGGAGATTACGCTGCCCGGTTCCATCACG
CAGGACGTCACCATCGCCATCGAGGATCATGGCCGCGACGACCCAGAGGTCTTTGACGTCGCCAAGGACTACGTC
TTCCAGGCCATGGAGCGAGACGCCTTCCCGGGCTTCCTGCGCATGAAGGCCCTGGGTAATCTGATTCCGCCAACC
CTCGTGATGCGCCTCATCATCGGCCTCGTCTCCATGTTCGCCGCCTTCTGGGCCGGTTTCGTCCTCATCTTTCTC
GACAGCTGGCGCACCACCAGATGCTGGCTCATCCTGCCCTTCACCGTGGGCGTCTACTTCCTCGCCTCATACCAA
TACTCCCTCGACCCCATCATGGCCCTTGTTGGCTTCAGCGAGTACACGCCCTTTAACTTCTCGCGCATCAGGGAG
CCCTACGTCCGCCAACTCCTCGCCAAGCGTGCCCTCATGGTTCTCGCCGTTACGTTGCTCGTTGATGCTGCGCTG
TGCCTGCTCTTCATCCTCGTGCCTGGCAAGAGGCTGTGA
Gene >Ophun1|4630
ATGTCCACCAAGATGGCACCGGCCAGTCCCTCGCCGCAGCCAGACCTCTCGCGCAACAGACTTCCAACCCTCTTC
GAGGTGCTGAGTCGGCGCACGCTTCCGCCTGTCGATCTCTTCTCCTTTTATATCTATATGCGCGACCAGCAGCGC
TCCGTCGACTACCTCGACTTCTGGTATGTTTGCTTTCACCCAATCGACTCCCGCATTATACTGACGCGCTTCCTT
TCAGGCTGGACGTGGCCCAACACATGTCGCTGTGCCGTCATTATGTGCGCGAGCTCCGCCGATCTGTCCTTGTCG
CCACGCCCGACGTCGACAAGGCTGGCTCCAAGAGATCGTCGGGCATCCTCGAGAGCCTGGGCGACCTCGAGCCTC
GCACGGCCGGCCCCTCCATGTACACGTCGGAGAAAGAGAGGGATCAAGATGCGCAGATGTCGGCCTTTTTGCGAG
AGGACCTGCCTCACGACTCGGCTCACAGCGGCTCCGGCGTCATTCGCCCCAGCCCGCAGTTCAGCACCCCTCGCG
ACGTAACCGACTCCAACTCGCCCGCCCACACCGTCGCCCGCCAGGATATCCGCGCCTCGGCTGAGAAGATCCTCT
ACACTTTCCTGCTACCCGGTGCAGAGCGGGAGATTACGCTGCCCGGTTCCATCACGCAGGACGTCACCATCGCCA
TCGAGGATCATGGCCGCGACGACCCAGAGGTCTTTGACGTCGCCAAGGACTACGTCTTCCAGGCCATGGAGCGAG
ACGCCTTCCCGGGCTTCCTGCGCATGAAGGCCCTGGGTAATCTGATTCCGCCAACCCTCGTGATGCGCCTCATCA
TCGGCCTCGTCTCCATGTTCGCCGCCTTCTGGGCCGGTTTCGTCCTCATCTTTCTCGACAGCTGGCGCACCACCA
GATGCTGGGTGAGTCGGAACCTCCCCCCCCTTTCAAACTCTCCCGTCTCAGCACACACAGCTAGCTAACCTGCTC
TTCAAAGCTCATCCTGCCCTTCACCGTGGGCGTCTACTTCCTCGCCTCATACCAATACTCCCTCGACCCCATCAT
GGCCCTTGTTGGCTTCAGCGAGTACACGCCCTTTAACTTCTCGCGCATCAGGGAGCCCTACGTCCGCCAACTCCT
CGCCAAGCGTGCCCTCATGGTTCTCGCCGTTACGTTGCTCGTTGATGCTGCGCTGTGCCTGCTCTTCATCCTCGT
GCCTGGCAAGAGGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail