Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4629
Gene name
LocationContig_430:11677..12184
Strand-
Gene length (bp)507
Transcript length (bp)378
Coding sequence length (bp)378
Protein length (aa) 126

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01198 Ribosomal_L31e Ribosomal protein L31e 5.1E-40 20 101

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C2H8|RL31A_YEAST 60S ribosomal protein L31-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL31A PE=1 SV=1 16 125 1.0E-47
sp|P0C2H9|RL31B_YEAST 60S ribosomal protein L31-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL31B PE=1 SV=1 16 125 1.0E-47
sp|Q6FWF4|RL31_CANGA 60S ribosomal protein L31 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPL31 PE=3 SV=1 16 125 3.0E-47
sp|Q9XGL4|RL31_CYAPA 60S ribosomal protein L31 OS=Cyanophora paradoxa GN=RPL31 PE=3 SV=1 9 120 1.0E-46
sp|Q90YT7|RL31_ICTPU 60S ribosomal protein L31 OS=Ictalurus punctatus GN=rpl31 PE=2 SV=1 15 125 1.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C2H8|RL31A_YEAST 60S ribosomal protein L31-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL31A PE=1 SV=1 16 125 1.0E-47
sp|P0C2H9|RL31B_YEAST 60S ribosomal protein L31-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL31B PE=1 SV=1 16 125 1.0E-47
sp|Q6FWF4|RL31_CANGA 60S ribosomal protein L31 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPL31 PE=3 SV=1 16 125 3.0E-47
sp|Q9XGL4|RL31_CYAPA 60S ribosomal protein L31 OS=Cyanophora paradoxa GN=RPL31 PE=3 SV=1 9 120 1.0E-46
sp|Q90YT7|RL31_ICTPU 60S ribosomal protein L31 OS=Ictalurus punctatus GN=rpl31 PE=2 SV=1 15 125 1.0E-44
sp|Q9IA76|RL31_PAROL 60S ribosomal protein L31 OS=Paralichthys olivaceus GN=rpl31 PE=2 SV=1 6 125 1.0E-44
sp|Q9M573|RL31_PERFR 60S ribosomal protein L31 OS=Perilla frutescens GN=RPL31 PE=2 SV=1 20 125 2.0E-43
sp|Q6NUH0|RL31_XENLA 60S ribosomal protein L31 OS=Xenopus laevis GN=rpl31 PE=2 SV=1 15 125 3.0E-43
sp|Q56JX3|RL31_BOVIN 60S ribosomal protein L31 OS=Bos taurus GN=RPL31 PE=2 SV=1 15 125 1.0E-42
sp|P62899|RL31_HUMAN 60S ribosomal protein L31 OS=Homo sapiens GN=RPL31 PE=1 SV=1 15 125 1.0E-42
sp|Q1KSC7|RL31_MARMO 60S ribosomal protein L31 OS=Marmota monax GN=RPL31 PE=2 SV=1 15 125 1.0E-42
sp|P62900|RL31_MOUSE 60S ribosomal protein L31 OS=Mus musculus GN=Rpl31 PE=1 SV=1 15 125 1.0E-42
sp|P62901|RL31_PIG 60S ribosomal protein L31 OS=Sus scrofa GN=RPL31 PE=1 SV=1 15 125 1.0E-42
sp|P62902|RL31_RAT 60S ribosomal protein L31 OS=Rattus norvegicus GN=Rpl31 PE=2 SV=1 15 125 1.0E-42
sp|O65071|RL31_PICMA 60S ribosomal protein L31 OS=Picea mariana GN=RPL31 PE=2 SV=1 11 125 2.0E-42
sp|Q5RBR9|RL31_PONAB 60S ribosomal protein L31 OS=Pongo abelii GN=RPL31 PE=2 SV=1 15 124 2.0E-42
sp|Q757D7|RL31_ASHGO 60S ribosomal protein L31 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL31 PE=3 SV=2 16 125 3.0E-42
sp|Q9STR1|RL312_ARATH 60S ribosomal protein L31-2 OS=Arabidopsis thaliana GN=RPL31B PE=3 SV=1 20 125 7.0E-40
sp|P45841|RL31_CHLRE 60S ribosomal protein L31 OS=Chlamydomonas reinhardtii GN=RPL31 PE=3 SV=1 22 125 7.0E-40
sp|Q9SLL7|RL311_ARATH 60S ribosomal protein L31-1 OS=Arabidopsis thaliana GN=RPL31A PE=3 SV=1 20 125 8.0E-40
sp|P51420|RL313_ARATH 60S ribosomal protein L31-3 OS=Arabidopsis thaliana GN=RPL31C PE=2 SV=2 20 125 8.0E-40
sp|Q54XB5|RL31_DICDI 60S ribosomal protein L31 OS=Dictyostelium discoideum GN=rpl31 PE=3 SV=1 19 125 3.0E-38
sp|Q7KF90|RL31_SPOFR 60S ribosomal protein L31 OS=Spodoptera frugiperda GN=RpL31 PE=2 SV=1 8 120 1.0E-36
sp|Q9GP16|RL31_HELVI 60S ribosomal protein L31 OS=Heliothis virescens GN=RpL31 PE=2 SV=1 8 120 1.0E-36
sp|Q9URX6|RL31_SCHPO 60S ribosomal protein L31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl31 PE=3 SV=1 11 124 2.0E-36
sp|P46290|RL31_NICGU 60S ribosomal protein L31 OS=Nicotiana glutinosa GN=RPL31 PE=2 SV=1 20 125 2.0E-34
sp|Q9MAV7|RL31_PANGI 60S ribosomal protein L31 OS=Panax ginseng GN=RPL31 PE=2 SV=1 20 125 1.0E-32
sp|Q9V597|RL31_DROME 60S ribosomal protein L31 OS=Drosophila melanogaster GN=RpL31 PE=1 SV=1 1 124 1.0E-32
sp|Q22DH9|RL31_TETTS 60S ribosomal protein L31 OS=Tetrahymena thermophila (strain SB210) GN=RPL31 PE=1 SV=1 23 120 1.0E-29
sp|Q9GN74|RL31_AEDAE 60S ribosomal protein L31 OS=Aedes aegypti GN=RpL31 PE=2 SV=1 16 124 2.0E-28
sp|O18602|RL31_DROVI 60S ribosomal protein L31 OS=Drosophila virilis GN=RpL31 PE=3 SV=1 6 124 3.0E-28
sp|Q9U332|RL31_CAEEL 60S ribosomal protein L31 OS=Caenorhabditis elegans GN=rpl-31 PE=3 SV=1 12 124 8.0E-28
sp|P54009|RL31_METJA 50S ribosomal protein L31e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl31e PE=3 SV=1 23 88 3.0E-10
sp|Q8TUY4|RL31_METKA 50S ribosomal protein L31e OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl31e PE=3 SV=1 18 88 2.0E-09
sp|A6UR55|RL31_METVS 50S ribosomal protein L31e OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl31e PE=3 SV=1 24 88 2.0E-09
sp|A9A8N0|RL31_METM6 50S ribosomal protein L31e OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl31e PE=3 SV=1 24 89 7.0E-09
sp|Q6M155|RL31_METMP 50S ribosomal protein L31e OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl31e PE=3 SV=1 24 89 8.0E-09
sp|A6VI49|RL31_METM7 50S ribosomal protein L31e OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl31e PE=3 SV=1 24 89 1.0E-08
sp|A4G0C8|RL31_METM5 50S ribosomal protein L31e OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl31e PE=3 SV=1 24 89 2.0E-08
sp|A6UT96|RL31_META3 50S ribosomal protein L31e OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl31e PE=3 SV=1 24 89 3.0E-08
sp|Q8U3S7|RL31_PYRFU 50S ribosomal protein L31e OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl31e PE=1 SV=1 41 89 6.0E-08
sp|A3CWZ5|RL31_METMJ 50S ribosomal protein L31e OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl31e PE=3 SV=1 41 88 8.0E-08
sp|B8GEU5|RL31_METPE 50S ribosomal protein L31e OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rpl31e PE=3 SV=1 41 88 2.0E-07
sp|A7I9I7|RL31_METB6 50S ribosomal protein L31e OS=Methanoregula boonei (strain 6A8) GN=rpl31e PE=3 SV=1 41 88 9.0E-07
sp|A8A968|RL31_IGNH4 50S ribosomal protein L31e OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl31e PE=3 SV=1 26 114 2.0E-06
sp|B6YWY3|RL31_THEON 50S ribosomal protein L31e OS=Thermococcus onnurineus (strain NA1) GN=rpl31e PE=3 SV=1 26 104 3.0E-06
sp|Q9UYI7|RL31_PYRAB 50S ribosomal protein L31e OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl31e PE=3 SV=1 26 107 3.0E-06
sp|O27649|RL31_METTH 50S ribosomal protein L31e OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl31e PE=3 SV=1 42 88 5.0E-06
sp|Q2FS98|RL31_METHJ 50S ribosomal protein L31e OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl31e PE=3 SV=1 41 88 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1645
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3097
Ophiocordyceps australis map64 (Brazil) OphauB2|4486
Ophiocordyceps camponoti-floridani Ophcf2|03319
Ophiocordyceps camponoti-rufipedis Ophun1|4629 (this protein)
Ophiocordyceps kimflemingae Ophio5|5314
Ophiocordyceps subramaniannii Hirsu2|1337

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4629
MSSTKAKKPSGKAQRSAIADVVSREYTINMHKRLHGCTFKKRAPRAIKEIKAFATKSMGTSDVRIDPQLNKKVWE
CGVKGVPFKLRVRISRRRNDEEDAKEKLYSYVQAVNVKNPKGLATVVVED*
Coding >Ophun1|4629
ATGTCGTCGACCAAGGCAAAGAAGCCCAGCGGCAAGGCCCAGCGCTCCGCCATCGCGGACGTCGTCTCCCGCGAG
TACACCATCAACATGCACAAGAGGTTACACGGCTGCACCTTCAAGAAGAGGGCTCCTCGCGCTATCAAGGAGATC
AAGGCCTTTGCCACCAAGTCCATGGGCACCTCTGACGTCCGTATCGACCCCCAGCTCAACAAGAAAGTGTGGGAG
TGCGGCGTCAAGGGCGTTCCATTCAAGCTCCGCGTCCGCATCTCGCGCCGACGAAACGACGAGGAGGACGCCAAG
GAGAAGCTGTACAGCTACGTGCAGGCAGTCAACGTCAAGAACCCCAAGGGCCTCGCCACGGTCGTCGTCGAGGAC
TAA
Transcript >Ophun1|4629
ATGTCGTCGACCAAGGCAAAGAAGCCCAGCGGCAAGGCCCAGCGCTCCGCCATCGCGGACGTCGTCTCCCGCGAG
TACACCATCAACATGCACAAGAGGTTACACGGCTGCACCTTCAAGAAGAGGGCTCCTCGCGCTATCAAGGAGATC
AAGGCCTTTGCCACCAAGTCCATGGGCACCTCTGACGTCCGTATCGACCCCCAGCTCAACAAGAAAGTGTGGGAG
TGCGGCGTCAAGGGCGTTCCATTCAAGCTCCGCGTCCGCATCTCGCGCCGACGAAACGACGAGGAGGACGCCAAG
GAGAAGCTGTACAGCTACGTGCAGGCAGTCAACGTCAAGAACCCCAAGGGCCTCGCCACGGTCGTCGTCGAGGAC
TAA
Gene >Ophun1|4629
ATGTCGTCGACCAAGGCAAAGAAGCCCAGCGGCAAGGCCCAGCGCTCCGCCATCGCGGACGTCGTCTCCCGCGAG
TACACCATCAACATGCACAAGAGGGTATGTCCCGGCCGAGGATGGCAACCAGCGCCCGTTGCTTGCGAGGGGCTG
ACGGAGCTTTGACGGCGAAAAGTTACACGGCTGCACCTTCAAGAAGAGGGCTCCTCGCGCTATCAAGGAGATCAA
GGCCTTTGCCACCAAGTCCATGGTATATCCTGCCAATTGCCACAATCACCGAGACGAGGCGCTGACACGACCGGT
CAGGGCACCTCTGACGTCCGTATCGACCCCCAGCTCAACAAGAAAGTGTGGGAGTGCGGCGTCAAGGGCGTTCCA
TTCAAGCTCCGCGTCCGCATCTCGCGCCGACGAAACGACGAGGAGGACGCCAAGGAGAAGCTGTACAGCTACGTG
CAGGCAGTCAACGTCAAGAACCCCAAGGGCCTCGCCACGGTCGTCGTCGAGGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail