Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|462
Gene name
LocationContig_113:13599..15838
Strand-
Gene length (bp)2239
Transcript length (bp)2136
Coding sequence length (bp)2136
Protein length (aa) 712

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 8.8E-05 116 213

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup515
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7433
Ophiocordyceps australis map64 (Brazil) OphauB2|1555
Ophiocordyceps australis map64 (Brazil) OphauB2|595
Ophiocordyceps camponoti-floridani Ophcf2|06721
Ophiocordyceps camponoti-floridani Ophcf2|07183
Ophiocordyceps camponoti-rufipedis Ophun1|2349
Ophiocordyceps camponoti-rufipedis Ophun1|462 (this protein)
Ophiocordyceps kimflemingae Ophio5|3679
Ophiocordyceps subramaniannii Hirsu2|226

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|462
MRPGDWTSLALAVSWTLQYPSQIQARFSSKRPPPTDAPEVYQVPAVEPSVLYFMCALAPGPSWLRAAGGLSPRLP
DPSPDEAWGYATVSGLGGAWAQLWRDWMDRTALEANWDFASTLYLYEVSTCPNIVSHYSQPELNRAYWALGGFLW
SQVVRYAALNPGDDMQNPSWINNSDFNADWESFHTSGWQPELSGYSLGHPIWRDGDWMDRVPAVAMTRHEQALLF
VRGIMQNTLLRSLFDWRGDFPLVRVSDSALSVPLSEIGGQSAIESFQLDTLRLPDDVARTLREKERLSGEACRVI
SLAISLSVWKHIDHQSHRRGWRQTGVRHGDEEYCQAAKETNQCVSDAEADDCRALSNAIGKLKAASLTNTRSYGT
EGLPRTACSRLRRIRFILDIADEHGAGTYDEISARVGISSSFIIADEPHTPSRGDSIQSELSLKEGFQSETVAVN
EIDRISISARRVNVFGADWWKIKGVRLVGQCSDSLTTIQLDKFASINQQVQSGSEWQTWTEVWAGPVWPEDWNVA
NYCTHLESVEIEVQLGSSLAAGTWDDIMVQVGHQELTMMKQPSAGAYKRTRVDLKQAFGAADGVISVTQPIKFSV
FSVPDGRAIGDSWKLRGKPMERSLRLSVPSNATRAAGITFRSRCQRSGKVYKIDKYADIQVWRLRDEGHESHFSG
KVSLRDWQEESKTAANYHEMPLGDWLKPIVVDRGRV*
Coding >Ophun1|462
ATGAGACCCGGAGACTGGACCAGTCTGGCCCTAGCGGTATCATGGACGCTCCAATATCCCAGCCAGATCCAGGCC
AGATTCTCAAGCAAGAGGCCTCCCCCGACAGACGCCCCAGAGGTGTATCAGGTGCCTGCCGTGGAGCCCAGCGTT
CTCTACTTCATGTGTGCCCTCGCCCCCGGCCCGAGCTGGCTGCGTGCCGCGGGCGGACTGTCCCCTCGACTGCCG
GACCCGAGCCCCGACGAGGCATGGGGCTACGCCACCGTCAGCGGCTTGGGCGGCGCCTGGGCCCAGCTCTGGAGG
GACTGGATGGACCGGACGGCGCTCGAGGCCAACTGGGACTTTGCATCGACCTTGTACTTGTACGAGGTCTCGACG
TGTCCCAACATCGTCTCTCATTATAGCCAGCCGGAGCTGAATCGCGCGTACTGGGCCTTAGGCGGCTTCCTGTGG
TCGCAGGTGGTGAGATACGCTGCCTTGAACCCGGGCGACGACATGCAGAACCCGTCGTGGATCAACAATAGCGAC
TTCAACGCGGATTGGGAGTCGTTCCACACCAGCGGCTGGCAGCCCGAGCTCTCGGGCTACAGCCTCGGCCATCCC
ATCTGGCGCGATGGCGACTGGATGGACCGCGTGCCGGCAGTGGCTATGACGCGCCACGAGCAAGCCCTCCTCTTC
GTCAGGGGCATTATGCAGAACACGCTGCTCAGGAGCCTGTTTGATTGGCGTGGCGATTTTCCCCTGGTCCGCGTC
TCAGACTCGGCCTTGTCAGTCCCCTTGTCCGAGATCGGCGGACAGAGCGCGATAGAAAGCTTCCAGCTGGATACG
CTGAGGTTGCCCGACGACGTGGCGCGGACGCTTAGAGAGAAGGAGAGGTTGTCCGGGGAAGCGTGTCGCGTCATC
TCTCTGGCCATCAGTCTCTCCGTCTGGAAGCACATCGACCACCAGTCTCACCGACGAGGATGGAGACAGACAGGG
GTAAGACACGGCGACGAAGAGTACTGCCAGGCGGCAAAGGAAACGAACCAGTGTGTCTCAGACGCAGAGGCGGAC
GACTGTCGTGCCCTGAGCAATGCCATCGGCAAGCTCAAGGCGGCCAGCCTGACCAACACCCGGAGCTATGGCACC
GAGGGCCTGCCGAGGACAGCCTGCAGCCGGCTCAGGAGAATCAGATTCATCCTGGACATCGCCGACGAGCATGGC
GCGGGGACGTACGACGAGATATCAGCCAGGGTCGGCATATCGTCGAGCTTCATCATCGCCGATGAGCCTCATACG
CCGTCGAGGGGAGATTCGATACAGTCGGAGCTGAGTTTGAAGGAAGGTTTCCAGTCTGAGACGGTGGCTGTCAAC
GAGATTGACCGCATCTCCATCTCTGCCAGACGCGTCAACGTGTTTGGTGCTGACTGGTGGAAGATCAAAGGCGTC
CGTCTCGTCGGCCAATGCAGCGACTCTCTCACCACGATCCAGCTCGACAAGTTCGCGTCCATCAACCAGCAAGTC
CAGAGCGGAAGCGAGTGGCAGACATGGACCGAGGTCTGGGCCGGCCCCGTCTGGCCCGAGGACTGGAACGTGGCC
AACTACTGCACCCACCTGGAGAGTGTCGAGATCGAGGTCCAACTTGGCAGCAGCTTGGCAGCCGGCACCTGGGAT
GACATTATGGTCCAGGTCGGCCACCAGGAGCTGACTATGATGAAGCAGCCCTCAGCCGGGGCTTACAAGAGGACG
CGAGTCGACCTGAAGCAAGCCTTCGGAGCCGCTGATGGCGTCATATCCGTGACGCAGCCCATCAAGTTCTCCGTC
TTCTCCGTGCCCGACGGACGCGCCATCGGAGACTCGTGGAAGTTGAGAGGCAAGCCCATGGAACGATCCCTCCGG
TTGTCTGTGCCTTCTAACGCGACGCGTGCTGCAGGCATCACCTTTCGATCTCGATGTCAGCGGTCTGGCAAGGTT
TACAAGATCGACAAATATGCAGACATCCAAGTGTGGCGCCTGCGTGACGAAGGACACGAAAGCCACTTCAGCGGC
AAAGTTTCGTTGAGAGACTGGCAGGAGGAGTCGAAGACGGCGGCGAATTACCACGAGATGCCTCTCGGTGATTGG
CTCAAGCCCATCGTAGTCGACAGGGGGAGGGTGTAA
Transcript >Ophun1|462
ATGAGACCCGGAGACTGGACCAGTCTGGCCCTAGCGGTATCATGGACGCTCCAATATCCCAGCCAGATCCAGGCC
AGATTCTCAAGCAAGAGGCCTCCCCCGACAGACGCCCCAGAGGTGTATCAGGTGCCTGCCGTGGAGCCCAGCGTT
CTCTACTTCATGTGTGCCCTCGCCCCCGGCCCGAGCTGGCTGCGTGCCGCGGGCGGACTGTCCCCTCGACTGCCG
GACCCGAGCCCCGACGAGGCATGGGGCTACGCCACCGTCAGCGGCTTGGGCGGCGCCTGGGCCCAGCTCTGGAGG
GACTGGATGGACCGGACGGCGCTCGAGGCCAACTGGGACTTTGCATCGACCTTGTACTTGTACGAGGTCTCGACG
TGTCCCAACATCGTCTCTCATTATAGCCAGCCGGAGCTGAATCGCGCGTACTGGGCCTTAGGCGGCTTCCTGTGG
TCGCAGGTGGTGAGATACGCTGCCTTGAACCCGGGCGACGACATGCAGAACCCGTCGTGGATCAACAATAGCGAC
TTCAACGCGGATTGGGAGTCGTTCCACACCAGCGGCTGGCAGCCCGAGCTCTCGGGCTACAGCCTCGGCCATCCC
ATCTGGCGCGATGGCGACTGGATGGACCGCGTGCCGGCAGTGGCTATGACGCGCCACGAGCAAGCCCTCCTCTTC
GTCAGGGGCATTATGCAGAACACGCTGCTCAGGAGCCTGTTTGATTGGCGTGGCGATTTTCCCCTGGTCCGCGTC
TCAGACTCGGCCTTGTCAGTCCCCTTGTCCGAGATCGGCGGACAGAGCGCGATAGAAAGCTTCCAGCTGGATACG
CTGAGGTTGCCCGACGACGTGGCGCGGACGCTTAGAGAGAAGGAGAGGTTGTCCGGGGAAGCGTGTCGCGTCATC
TCTCTGGCCATCAGTCTCTCCGTCTGGAAGCACATCGACCACCAGTCTCACCGACGAGGATGGAGACAGACAGGG
GTAAGACACGGCGACGAAGAGTACTGCCAGGCGGCAAAGGAAACGAACCAGTGTGTCTCAGACGCAGAGGCGGAC
GACTGTCGTGCCCTGAGCAATGCCATCGGCAAGCTCAAGGCGGCCAGCCTGACCAACACCCGGAGCTATGGCACC
GAGGGCCTGCCGAGGACAGCCTGCAGCCGGCTCAGGAGAATCAGATTCATCCTGGACATCGCCGACGAGCATGGC
GCGGGGACGTACGACGAGATATCAGCCAGGGTCGGCATATCGTCGAGCTTCATCATCGCCGATGAGCCTCATACG
CCGTCGAGGGGAGATTCGATACAGTCGGAGCTGAGTTTGAAGGAAGGTTTCCAGTCTGAGACGGTGGCTGTCAAC
GAGATTGACCGCATCTCCATCTCTGCCAGACGCGTCAACGTGTTTGGTGCTGACTGGTGGAAGATCAAAGGCGTC
CGTCTCGTCGGCCAATGCAGCGACTCTCTCACCACGATCCAGCTCGACAAGTTCGCGTCCATCAACCAGCAAGTC
CAGAGCGGAAGCGAGTGGCAGACATGGACCGAGGTCTGGGCCGGCCCCGTCTGGCCCGAGGACTGGAACGTGGCC
AACTACTGCACCCACCTGGAGAGTGTCGAGATCGAGGTCCAACTTGGCAGCAGCTTGGCAGCCGGCACCTGGGAT
GACATTATGGTCCAGGTCGGCCACCAGGAGCTGACTATGATGAAGCAGCCCTCAGCCGGGGCTTACAAGAGGACG
CGAGTCGACCTGAAGCAAGCCTTCGGAGCCGCTGATGGCGTCATATCCGTGACGCAGCCCATCAAGTTCTCCGTC
TTCTCCGTGCCCGACGGACGCGCCATCGGAGACTCGTGGAAGTTGAGAGGCAAGCCCATGGAACGATCCCTCCGG
TTGTCTGTGCCTTCTAACGCGACGCGTGCTGCAGGCATCACCTTTCGATCTCGATGTCAGCGGTCTGGCAAGGTT
TACAAGATCGACAAATATGCAGACATCCAAGTGTGGCGCCTGCGTGACGAAGGACACGAAAGCCACTTCAGCGGC
AAAGTTTCGTTGAGAGACTGGCAGGAGGAGTCGAAGACGGCGGCGAATTACCACGAGATGCCTCTCGGTGATTGG
CTCAAGCCCATCGTAGTCGACAGGGGGAGGGTGTAA
Gene >Ophun1|462
ATGAGACCCGGAGACTGGACCAGTCTGGCCCTAGCGGTATCATGGACGCTCCAATATCCCAGCCAGATCCAGGCC
AGATTCTCAAGCAAGAGGCCTCCCCCGACAGACGCCCCAGAGGTGTATCAGGTGCCTGCCGTGGAGCCCAGCGTT
CTCTACTTCATGTGTGCCCTCGCCCCCGGCCCGAGCTGGCTGCGTGCCGCGGGCGGACTGTCCCCTCGACTGCCG
GACCCGAGCCCCGACGAGGCATGGGGCTACGCCACCGTCAGCGGCTTGGGCGGCGCCTGGGCCCAGCTCTGGAGG
GACTGGATGGACCGGACGGCGCTCGAGGCCAACTGGGACTTTGCATCGACCTTGTACTTGTACGAGGTCTCGACG
TGTCCCAACATCGTCTCTCATTATAGCCAGCCGGAGCTGAATCGCGCGTACTGGGCCTTAGGCGGCTTCCTGTGG
TCGCAGGTGGTGAGATACGCTGCCTTGAACCCGGGCGACGACATGCAGAACCCGTCGTGGATCAACAATAGCGAC
TTCAACGCGGATTGGGAGTCGTTCCACACCAGCGGCTGGCAGCCCGAGCTCTCGGGCTACAGCCTCGGCCATCCC
ATCTGGCGCGATGGCGACTGGATGGACCGCGTGCCGGCAGTGGCTATGACGCGCCACGAGCAAGCCCTCCTCTTC
GTCAGGGGCATTATGCAGAACACGCTGCTCAGGAGCCTGTTTGATTGGCGTGGCGATTTTCCCCTGGTCCGCGTC
TCAGACTCGGCCTTGTCAGTCCCCTTGTCCGAGATCGGCGGACAGAGCGCGATAGAAAGCTTCCAGCTGGATACG
CTGAGGTTGCCCGACGACGTGGCGCGGACGCTTAGAGAGAAGGAGAGGTTGTCCGGGGAAGCGTGTCGCGTCATC
TCTCTGGCCATCAGTCTCTCCGTCTGGAAGCACATCGACCACCAGTCTCACCGACGAGGATGGAGACAGACAGGT
GCGTGGGAGCGGACAAGACACCAAGATCGAACTAACGAGAGAACAGGGGTAAGACACGGCGACGAAGAGTACTGC
CAGGCGGCAAAGGAAACGAACCAGTGTGTCTCAGACGCAGAGGCGGACGACTGTCGTGCCCTGAGCAATGCCATC
GGCAAGCTCAAGGCGGCCAGCCTGACCAACACCCGGAGCTATGGCACCGAGGGCCTGCCGAGGACAGCCTGCAGC
CGGCTCAGGAGAATCAGATTCATCCTGGACATCGCCGACGAGCATGGCGCGGGGACGTACGACGAGATATCAGCC
AGGGTCGGCATATCGTCGAGCTTCATCATCGCCGATGAGCCTCATACGCCGTCGAGGGGAGATTCGATACAGTCG
GAGCTGAGTTTGAAGGAAGGTTTCCAGTCTGAGACGGTGGCTGTCAACGAGATTGACCGCATCTCCATCTCTGCC
AGACGCGTCAACGTGTTTGGTGCTGACTGGTGGAAGATCAAAGGTGAGTTTCCCTCTTTCAAGAAGACGACGACG
GAAGATGGCTCAAGACTTTGCAGGCGTCCGTCTCGTCGGCCAATGCAGCGACTCTCTCACCACGATCCAGCTCGA
CAAGTTCGCGTCCATCAACCAGCAAGTCCAGAGCGGAAGCGAGTGGCAGACATGGACCGAGGTCTGGGCCGGCCC
CGTCTGGCCCGAGGACTGGAACGTGGCCAACTACTGCACCCACCTGGAGAGTGTCGAGATCGAGGTCCAACTTGG
CAGCAGCTTGGCAGCCGGCACCTGGGATGACATTATGGTCCAGGTCGGCCACCAGGAGCTGACTATGATGAAGCA
GCCCTCAGCCGGGGCTTACAAGAGGACGCGAGTCGACCTGAAGCAAGCCTTCGGAGCCGCTGATGGCGTCATATC
CGTGACGCAGCCCATCAAGTTCTCCGTCTTCTCCGTGCCCGACGGACGCGCCATCGGAGACTCGTGGAAGTTGAG
AGGCAAGCCCATGGAACGATCCCTCCGGTTGTCTGTGCCTTCTAACGCGACGCGTGCTGCAGGCATCACCTTTCG
ATCTCGATGTCAGCGGTCTGGCAAGGTTTACAAGATCGACAAATATGCAGACATCCAAGTGTGGCGCCTGCGTGA
CGAAGGACACGAAAGCCACTTCAGCGGCAAAGTTTCGTTGAGAGACTGGCAGGAGGAGTCGAAGACGGCGGCGAA
TTACCACGAGATGCCTCTCGGTGATTGGCTCAAGCCCATCGTAGTCGACAGGGGGAGGGTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail