Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4617
Gene name
LocationContig_43:25111..26803
Strand+
Gene length (bp)1692
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13516 LRR_6 Leucine Rich repeat 2.4E-03 320 343

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74999|RAD7_SCHPO DNA repair protein rhp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp7 PE=3 SV=1 32 533 9.0E-37
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 304 539 6.0E-11
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 318 539 5.0E-10
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 297 544 9.0E-09
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 297 544 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74999|RAD7_SCHPO DNA repair protein rhp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp7 PE=3 SV=1 32 533 9.0E-37
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 304 539 6.0E-11
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 318 539 5.0E-10
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 297 544 9.0E-09
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 297 544 1.0E-08
sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 297 544 1.0E-08
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 311 528 1.0E-08
sp|Q708Y0|EBF2_ARATH EIN3-binding F-box protein 2 OS=Arabidopsis thaliana GN=EBF2 PE=1 SV=1 311 537 2.0E-07
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 290 512 2.0E-07
sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 310 513 3.0E-07
sp|Q9QZN1|FXL17_MOUSE F-box/LRR-repeat protein 17 OS=Mus musculus GN=Fbxl17 PE=2 SV=3 254 542 3.0E-07
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 349 542 3.0E-07
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 297 487 4.0E-07
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 307 533 6.0E-07
sp|Q9UF56|FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens GN=FBXL17 PE=2 SV=3 254 542 7.0E-07
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 365 537 7.0E-07
sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 356 537 2.0E-06
sp|A1A5X2|FBXL7_DANRE F-box/LRR-repeat protein 7 OS=Danio rerio GN=fbxl7 PE=2 SV=1 307 534 2.0E-06
sp|A1A5X2|FBXL7_DANRE F-box/LRR-repeat protein 7 OS=Danio rerio GN=fbxl7 PE=2 SV=1 192 525 2.0E-06
sp|E2RKN7|FXL15_CANLF F-box/LRR-repeat protein 15 OS=Canis lupus familiaris GN=FBXL15 PE=3 SV=1 224 441 2.0E-06
sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 307 534 2.0E-06
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 356 537 2.0E-06
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 356 537 2.0E-06
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 226 539 3.0E-06
sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 310 513 3.0E-06
sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 310 513 3.0E-06
sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 295 544 4.0E-06
sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 295 544 5.0E-06
sp|Q5BJ29|FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=1 SV=1 307 534 6.0E-06
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 310 534 6.0E-06
sp|P34284|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=3 SV=3 311 544 7.0E-06
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 295 544 8.0E-06
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 354 546 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4617
MLIACQSHNISARQIRDDAERRRQEAAELARQNGEELSAAAPEPRQEQQVQAKKSKSKKTSKKRKKQADDSDSEY
EELTRAMRAVQAPLPGQMENCETCGKRFTVTPYSVAGPDGGLLCSPCGRELAKQRVGQTKKPKPRKQVGGVGSRR
ALQSRILDGDVGTKSLATLCVQTLAKNVDMADSLGDLPDHLIDKIARLFSKRRLLRPETLPLFAQPSAEMVHIYD
GARLGGQEFISVFQVAPGLRRFKARCAIQFKDEVMDYLISRDTALESFYLHGANLLSEEKWHEFLVCKGQTLQGL
QVYYTDKHFGDESIKAAADHCPSLRRLKIEHNQKVTDKGVEAIGRISSLEHLGLQLQNQTSSRAIIKAVSKIGFQ
LKTLSLKVMPDVDDGVLEAIHTHCRNLEKLRITDSEQMTDAGFVELFTDWANPPLKFIDLQKCRYVDSSRPRQND
DNIGFCSEGFKALMAHSGAKLERLNVHACRHVTRQAFEDVFDGSTTYPELQKLEISFCEEVTDLVLGYIFRACPK
IKEVNVFGCMKVRNVRVPRGVILVGVPNAQGMITEGVD*
Coding >Ophun1|4617
ATGCTAATAGCCTGCCAGTCGCACAATATTTCTGCTCGCCAGATCAGAGACGATGCCGAAAGACGTCGCCAGGAA
GCGGCCGAACTCGCGCGGCAGAACGGAGAGGAACTTTCTGCTGCGGCCCCCGAGCCTCGTCAAGAGCAGCAGGTC
CAGGCGAAGAAATCTAAAAGCAAAAAGACCTCCAAGAAGCGCAAGAAGCAAGCAGACGACTCCGACTCAGAGTAC
GAGGAACTTACACGAGCCATGCGAGCGGTTCAAGCGCCTCTGCCGGGCCAGATGGAGAACTGCGAAACTTGCGGA
AAGCGCTTCACCGTGACGCCCTATTCCGTCGCTGGCCCTGACGGTGGTCTCTTGTGCTCCCCTTGCGGAAGGGAG
CTTGCTAAACAACGAGTCGGCCAAACAAAGAAGCCGAAGCCTCGCAAACAGGTCGGCGGTGTCGGTTCGCGACGC
GCTCTTCAAAGCCGCATCCTCGACGGTGATGTCGGCACCAAGAGCCTCGCCACATTGTGCGTGCAGACGCTGGCC
AAGAACGTCGACATGGCCGACAGCTTAGGCGACCTTCCGGATCACCTGATAGACAAGATAGCGAGGCTGTTCTCT
AAACGCAGGCTGCTGAGGCCCGAGACGCTACCACTGTTTGCGCAGCCGAGCGCCGAAATGGTGCACATCTACGAC
GGCGCGAGACTCGGCGGACAAGAGTTTATCAGCGTCTTTCAGGTCGCTCCCGGCCTGCGGAGATTCAAGGCCCGG
TGCGCGATTCAGTTCAAGGATGAGGTCATGGACTATCTCATCTCCCGGGACACTGCTCTCGAGAGCTTCTACCTC
CACGGCGCAAACCTATTGAGCGAAGAAAAGTGGCACGAGTTCCTTGTCTGCAAAGGGCAGACTCTGCAGGGCCTG
CAGGTTTACTACACGGACAAGCACTTTGGCGACGAGAGTATCAAGGCTGCCGCTGACCACTGTCCCAGTCTGCGG
CGGCTCAAGATAGAACACAACCAGAAGGTGACGGACAAGGGCGTCGAGGCCATCGGTCGGATATCGAGCCTGGAG
CACCTCGGGCTGCAGCTACAGAACCAGACGTCATCGCGAGCCATCATCAAGGCCGTGTCCAAGATCGGATTCCAG
CTCAAGACACTGTCCCTCAAGGTTATGCCCGATGTCGACGACGGCGTCCTCGAGGCCATCCACACACACTGTCGT
AACCTCGAGAAGCTGCGCATCACAGACAGCGAGCAGATGACAGACGCCGGCTTCGTCGAGCTCTTCACCGACTGG
GCGAACCCACCGCTCAAATTCATCGATCTGCAAAAGTGCCGCTACGTCGATTCGTCCCGACCGCGCCAGAACGAC
GACAACATCGGCTTCTGCAGCGAGGGCTTCAAGGCGCTGATGGCACACTCGGGCGCCAAGCTGGAGAGGCTCAAC
GTGCATGCTTGCCGGCACGTGACGAGACAGGCGTTTGAGGACGTGTTTGACGGATCGACGACGTACCCGGAGCTG
CAGAAGCTGGAGATTAGCTTCTGCGAGGAGGTGACGGATCTGGTTCTGGGGTACATCTTCCGGGCGTGTCCCAAG
ATCAAGGAGGTGAATGTCTTTGGCTGCATGAAGGTTAGGAATGTGAGGGTGCCGCGGGGGGTGATTCTGGTGGGA
GTGCCGAATGCGCAGGGGATGATTACGGAGGGTGTGGACTGA
Transcript >Ophun1|4617
ATGCTAATAGCCTGCCAGTCGCACAATATTTCTGCTCGCCAGATCAGAGACGATGCCGAAAGACGTCGCCAGGAA
GCGGCCGAACTCGCGCGGCAGAACGGAGAGGAACTTTCTGCTGCGGCCCCCGAGCCTCGTCAAGAGCAGCAGGTC
CAGGCGAAGAAATCTAAAAGCAAAAAGACCTCCAAGAAGCGCAAGAAGCAAGCAGACGACTCCGACTCAGAGTAC
GAGGAACTTACACGAGCCATGCGAGCGGTTCAAGCGCCTCTGCCGGGCCAGATGGAGAACTGCGAAACTTGCGGA
AAGCGCTTCACCGTGACGCCCTATTCCGTCGCTGGCCCTGACGGTGGTCTCTTGTGCTCCCCTTGCGGAAGGGAG
CTTGCTAAACAACGAGTCGGCCAAACAAAGAAGCCGAAGCCTCGCAAACAGGTCGGCGGTGTCGGTTCGCGACGC
GCTCTTCAAAGCCGCATCCTCGACGGTGATGTCGGCACCAAGAGCCTCGCCACATTGTGCGTGCAGACGCTGGCC
AAGAACGTCGACATGGCCGACAGCTTAGGCGACCTTCCGGATCACCTGATAGACAAGATAGCGAGGCTGTTCTCT
AAACGCAGGCTGCTGAGGCCCGAGACGCTACCACTGTTTGCGCAGCCGAGCGCCGAAATGGTGCACATCTACGAC
GGCGCGAGACTCGGCGGACAAGAGTTTATCAGCGTCTTTCAGGTCGCTCCCGGCCTGCGGAGATTCAAGGCCCGG
TGCGCGATTCAGTTCAAGGATGAGGTCATGGACTATCTCATCTCCCGGGACACTGCTCTCGAGAGCTTCTACCTC
CACGGCGCAAACCTATTGAGCGAAGAAAAGTGGCACGAGTTCCTTGTCTGCAAAGGGCAGACTCTGCAGGGCCTG
CAGGTTTACTACACGGACAAGCACTTTGGCGACGAGAGTATCAAGGCTGCCGCTGACCACTGTCCCAGTCTGCGG
CGGCTCAAGATAGAACACAACCAGAAGGTGACGGACAAGGGCGTCGAGGCCATCGGTCGGATATCGAGCCTGGAG
CACCTCGGGCTGCAGCTACAGAACCAGACGTCATCGCGAGCCATCATCAAGGCCGTGTCCAAGATCGGATTCCAG
CTCAAGACACTGTCCCTCAAGGTTATGCCCGATGTCGACGACGGCGTCCTCGAGGCCATCCACACACACTGTCGT
AACCTCGAGAAGCTGCGCATCACAGACAGCGAGCAGATGACAGACGCCGGCTTCGTCGAGCTCTTCACCGACTGG
GCGAACCCACCGCTCAAATTCATCGATCTGCAAAAGTGCCGCTACGTCGATTCGTCCCGACCGCGCCAGAACGAC
GACAACATCGGCTTCTGCAGCGAGGGCTTCAAGGCGCTGATGGCACACTCGGGCGCCAAGCTGGAGAGGCTCAAC
GTGCATGCTTGCCGGCACGTGACGAGACAGGCGTTTGAGGACGTGTTTGACGGATCGACGACGTACCCGGAGCTG
CAGAAGCTGGAGATTAGCTTCTGCGAGGAGGTGACGGATCTGGTTCTGGGGTACATCTTCCGGGCGTGTCCCAAG
ATCAAGGAGGTGAATGTCTTTGGCTGCATGAAGGTTAGGAATGTGAGGGTGCCGCGGGGGGTGATTCTGGTGGGA
GTGCCGAATGCGCAGGGGATGATTACGGAGGGTGTGGACTGA
Gene >Ophun1|4617
ATGCTAATAGCCTGCCAGTCGCACAATATTTCTGCTCGCCAGATCAGAGACGATGCCGAAAGACGTCGCCAGGAA
GCGGCCGAACTCGCGCGGCAGAACGGAGAGGAACTTTCTGCTGCGGCCCCCGAGCCTCGTCAAGAGCAGCAGGTC
CAGGCGAAGAAATCTAAAAGCAAAAAGACCTCCAAGAAGCGCAAGAAGCAAGCAGACGACTCCGACTCAGAGTAC
GAGGAACTTACACGAGCCATGCGAGCGGTTCAAGCGCCTCTGCCGGGCCAGATGGAGAACTGCGAAACTTGCGGA
AAGCGCTTCACCGTGACGCCCTATTCCGTCGCTGGCCCTGACGGTGGTCTCTTGTGCTCCCCTTGCGGAAGGGAG
CTTGCTAAACAACGAGTCGGCCAAACAAAGAAGCCGAAGCCTCGCAAACAGGTCGGCGGTGTCGGTTCGCGACGC
GCTCTTCAAAGCCGCATCCTCGACGGTGATGTCGGCACCAAGAGCCTCGCCACATTGTGCGTGCAGACGCTGGCC
AAGAACGTCGACATGGCCGACAGCTTAGGCGACCTTCCGGATCACCTGATAGACAAGATAGCGAGGCTGTTCTCT
AAACGCAGGCTGCTGAGGCCCGAGACGCTACCACTGTTTGCGCAGCCGAGCGCCGAAATGGTGCACATCTACGAC
GGCGCGAGACTCGGCGGACAAGAGTTTATCAGCGTCTTTCAGGTCGCTCCCGGCCTGCGGAGATTCAAGGCCCGG
TGCGCGATTCAGTTCAAGGATGAGGTCATGGACTATCTCATCTCCCGGGACACTGCTCTCGAGAGCTTCTACCTC
CACGGCGCAAACCTATTGAGCGAAGAAAAGTGGCACGAGTTCCTTGTCTGCAAAGGGCAGACTCTGCAGGGCCTG
CAGGTTTACTACACGGACAAGCACTTTGGCGACGAGAGTATCAAGGCTGCCGCTGACCACTGTCCCAGTCTGCGG
CGGCTCAAGATAGAACACAACCAGAAGGTGACGGACAAGGGCGTCGAGGCCATCGGTCGGATATCGAGCCTGGAG
CACCTCGGGCTGCAGCTACAGAACCAGACGTCATCGCGAGCCATCATCAAGGCCGTGTCCAAGATCGGATTCCAG
CTCAAGACACTGTCCCTCAAGGTTATGCCCGATGTCGACGACGGCGTCCTCGAGGCCATCCACACACACTGTCGT
AACCTCGAGAAGCTGCGCATCACAGACAGCGAGCAGATGACAGACGCCGGCTTCGTCGAGCTCTTCACCGACTGG
GCGAACCCACCGCTCAAATTCATCGATCTGCAAAAGTGCCGCTACGTCGATTCGTCCCGACCGCGCCAGAACGAC
GACAACATCGGCTTCTGCAGCGAGGGCTTCAAGGCGCTGATGGCACACTCGGGCGCCAAGCTGGAGAGGCTCAAC
GTGCATGCTTGCCGGCACGTGACGAGACAGGCGTTTGAGGACGTGTTTGACGGATCGACGACGTACCCGGAGCTG
CAGAAGCTGGAGATTAGCTTCTGCGAGGAGGTGACGGATCTGGTTCTGGGGTACATCTTCCGGGCGTGTCCCAAG
ATCAAGGAGGTGAATGTCTTTGGCTGCATGAAGGTTAGGAATGTGAGGGTGCCGCGGGGGGTGATTCTGGTGGGA
GTGCCGAATGCGCAGGGGATGATTACGGAGGGTGTGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail