Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|46
Gene name
LocationContig_1:121544..122624
Strand-
Gene length (bp)1080
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 2.8E-18 26 169
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.1E-09 31 162
PF08659 KR KR domain 1.4E-05 27 116

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 24 305 4.0E-24
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 24 312 1.0E-23
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 24 305 4.0E-23
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 24 305 5.0E-23
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 24 305 9.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 24 305 4.0E-24
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 24 312 1.0E-23
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 24 305 4.0E-23
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 24 305 5.0E-23
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 24 305 9.0E-23
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 24 312 3.0E-22
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 24 312 4.0E-22
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 24 307 9.0E-22
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 24 319 1.0E-21
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 21 314 2.0E-19
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 21 229 2.0E-19
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 21 283 4.0E-19
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 24 318 6.0E-19
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 21 250 1.0E-18
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 24 306 1.0E-18
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 24 317 3.0E-18
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 21 283 8.0E-18
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 20 283 2.0E-17
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 21 240 2.0E-16
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 21 237 2.0E-15
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 20 306 2.0E-13
sp|Q08651|ENV9_YEAST Probable oxidoreductase ENV9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV9 PE=1 SV=1 15 281 3.0E-12
sp|A0PJE2|DHR12_HUMAN Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=2 SV=2 19 266 5.0E-12
sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 19 237 6.0E-12
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 25 313 1.0E-10
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 21 234 6.0E-10
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 24 307 8.0E-10
sp|P35320|OXIR_STRLI Probable oxidoreductase OS=Streptomyces lividans PE=3 SV=1 21 282 1.0E-09
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 21 282 4.0E-09
sp|O80333|POR_MARPA Protochlorophyllide reductase, chloroplastic OS=Marchantia paleacea GN=PORA PE=2 SV=1 16 149 6.0E-09
sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 26 288 7.0E-09
sp|Q5RCU5|CBR1_PONAB Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3 26 288 8.0E-09
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 19 235 2.0E-08
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 25 307 2.0E-08
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 25 237 3.0E-08
sp|Q39617|POR_CHLRE Protochlorophyllide reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PORA PE=3 SV=1 25 165 8.0E-08
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 25 235 9.0E-08
sp|Q23116|YWC4_CAEEL Uncharacterized oxidoreductase W01C9.4 OS=Caenorhabditis elegans GN=W01C9.4 PE=3 SV=1 24 143 1.0E-07
sp|O48741|PORC_ARATH Protochlorophyllide reductase C, chloroplastic OS=Arabidopsis thaliana GN=PORC PE=1 SV=1 18 137 1.0E-07
sp|Q42536|PORA_ARATH Protochlorophyllide reductase A, chloroplastic OS=Arabidopsis thaliana GN=PORA PE=1 SV=2 27 144 1.0E-07
sp|P48758|CBR1_MOUSE Carbonyl reductase [NADPH] 1 OS=Mus musculus GN=Cbr1 PE=1 SV=3 26 288 2.0E-07
sp|P47844|CBR1_RABIT Carbonyl reductase [NADPH] 1 OS=Oryctolagus cuniculus GN=CBR1 PE=2 SV=2 25 288 2.0E-07
sp|O66148|POR_LEPBY Light-dependent protochlorophyllide reductase OS=Leptolyngbya boryana GN=por PE=3 SV=2 27 237 2.0E-07
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 24 249 3.0E-07
sp|Q41249|PORA_CUCSA Protochlorophyllide reductase, chloroplastic OS=Cucumis sativus GN=PORA PE=2 SV=1 27 137 4.0E-07
sp|Q7T2D1|RD10B_DANRE Retinol dehydrogenase 10-B OS=Danio rerio GN=rdh10b PE=2 SV=2 10 239 7.0E-07
sp|P72332|NODG_RHIS3 Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 21 235 1.0E-06
sp|A1L1W4|RD10A_DANRE Retinol dehydrogenase 10-A OS=Danio rerio GN=rdh10a PE=2 SV=1 10 239 2.0E-06
sp|Q22230|DECR_CAEEL Probable 2,4-dienoyl-CoA reductase 3 OS=Caenorhabditis elegans GN=decr-1.3 PE=3 SV=1 24 143 2.0E-06
sp|Q01289|POR_PEA Protochlorophyllide reductase, chloroplastic OS=Pisum sativum GN=3PCR PE=1 SV=1 27 137 3.0E-06
sp|Q53877|DNRU_STRS5 Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces sp. (strain C5) PE=3 SV=1 18 314 3.0E-06
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 13 147 3.0E-06
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 17 282 4.0E-06
sp|Q9SDT1|POR_DAUCA Protochlorophyllide reductase, chloroplastic OS=Daucus carota GN=POR1 PE=2 SV=1 27 137 5.0E-06
sp|P21218|PORB_ARATH Protochlorophyllide reductase B, chloroplastic OS=Arabidopsis thaliana GN=PORB PE=1 SV=3 27 137 6.0E-06
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 13 147 6.0E-06
sp|Q9ZAU1|DNRU_STRPE Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces peucetius GN=dnrU PE=3 SV=1 18 314 7.0E-06
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 24 269 9.0E-06
sp|P31808|YCIK_ECOLI Uncharacterized oxidoreductase YciK OS=Escherichia coli (strain K12) GN=yciK PE=1 SV=3 18 140 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|46
MFAFLTSSLGQIWSLPYPEEDCTGRVVIVSGANTGLGREAARHFTRLNAAKVILACRNVDKAEAARRDIEVTTGR
SGVVESWQLDLSAVDSVKAFTDRAAALDRLDILVNNASVLSIEWSLADGHETMVTVNVISTFLLTLRLLPVMRRT
AMRFNVTPHVVIVSSDASFLTSFPERHAENIIQRLQLNQQYQDRYNVTKLLQLMATRELARACDASAKSNVIINA
LNPGFCDTELFRAVPAPFSLVIRFGLAIFGRTPEMGSRTLMSAAFAGHDTHGRYMTNCRMHSWPSLIDGAEGERL
CQRFWRELVQVLDDIDPDVSKNI*
Coding >Ophun1|46
ATGTTCGCCTTCCTCACCTCGTCGCTGGGCCAGATCTGGAGTCTCCCGTATCCAGAAGAGGACTGCACAGGACGC
GTCGTCATCGTCAGCGGAGCCAACACCGGCCTCGGTCGCGAAGCAGCTCGCCACTTCACCCGCCTCAATGCTGCC
AAAGTGATTCTCGCCTGTCGCAATGTCGACAAGGCTGAAGCCGCGAGACGCGACATTGAGGTGACGACGGGCCGC
TCTGGCGTCGTCGAGTCTTGGCAGCTCGATCTCTCCGCTGTGGATAGCGTCAAGGCCTTTACCGACCGCGCGGCT
GCGCTTGATCGGCTGGATATCCTCGTCAATAATGCCAGCGTCTTGTCCATAGAATGGTCCTTGGCCGATGGGCAC
GAGACTATGGTTACCGTCAACGTCATCTCGACTTTTCTACTGACGCTGCGGCTTCTGCCTGTGATGCGGCGCACC
GCTATGCGATTCAACGTGACGCCTCACGTTGTCATTGTCTCGTCTGATGCCTCCTTCTTGACTTCCTTTCCCGAA
CGGCACGCGGAGAACATCATCCAGCGGCTTCAGCTCAATCAACAGTATCAAGATCGCTACAACGTCACCAAGCTG
CTGCAGCTGATGGCAACACGCGAACTCGCCCGCGCCTGTGACGCCTCAGCAAAGAGCAACGTCATCATCAACGCA
CTCAATCCAGGCTTCTGCGATACAGAACTGTTTCGCGCCGTGCCCGCTCCCTTTAGCCTCGTCATTCGCTTTGGC
TTGGCCATCTTCGGACGCACCCCGGAGATGGGCTCGCGTACACTCATGTCTGCTGCCTTTGCTGGCCATGACACT
CACGGCCGCTACATGACCAACTGCCGTATGCATAGTTGGCCGTCGCTCATCGATGGCGCTGAAGGGGAGCGTCTT
TGTCAACGGTTTTGGCGTGAGCTGGTTCAGGTGCTCGACGATATAGACCCGGATGTCTCCAAGAATATCTAG
Transcript >Ophun1|46
ATGTTCGCCTTCCTCACCTCGTCGCTGGGCCAGATCTGGAGTCTCCCGTATCCAGAAGAGGACTGCACAGGACGC
GTCGTCATCGTCAGCGGAGCCAACACCGGCCTCGGTCGCGAAGCAGCTCGCCACTTCACCCGCCTCAATGCTGCC
AAAGTGATTCTCGCCTGTCGCAATGTCGACAAGGCTGAAGCCGCGAGACGCGACATTGAGGTGACGACGGGCCGC
TCTGGCGTCGTCGAGTCTTGGCAGCTCGATCTCTCCGCTGTGGATAGCGTCAAGGCCTTTACCGACCGCGCGGCT
GCGCTTGATCGGCTGGATATCCTCGTCAATAATGCCAGCGTCTTGTCCATAGAATGGTCCTTGGCCGATGGGCAC
GAGACTATGGTTACCGTCAACGTCATCTCGACTTTTCTACTGACGCTGCGGCTTCTGCCTGTGATGCGGCGCACC
GCTATGCGATTCAACGTGACGCCTCACGTTGTCATTGTCTCGTCTGATGCCTCCTTCTTGACTTCCTTTCCCGAA
CGGCACGCGGAGAACATCATCCAGCGGCTTCAGCTCAATCAACAGTATCAAGATCGCTACAACGTCACCAAGCTG
CTGCAGCTGATGGCAACACGCGAACTCGCCCGCGCCTGTGACGCCTCAGCAAAGAGCAACGTCATCATCAACGCA
CTCAATCCAGGCTTCTGCGATACAGAACTGTTTCGCGCCGTGCCCGCTCCCTTTAGCCTCGTCATTCGCTTTGGC
TTGGCCATCTTCGGACGCACCCCGGAGATGGGCTCGCGTACACTCATGTCTGCTGCCTTTGCTGGCCATGACACT
CACGGCCGCTACATGACCAACTGCCGTATGCATAGTTGGCCGTCGCTCATCGATGGCGCTGAAGGGGAGCGTCTT
TGTCAACGGTTTTGGCGTGAGCTGGTTCAGGTGCTCGACGATATAGACCCGGATGTCTCCAAGAATATCTAG
Gene >Ophun1|46
ATGTTCGCCTTCCTCACCTCGTCGCTGGGCCAGATCTGGAGTCTCCCGTATCCAGAAGAGGACTGCACAGGACGC
GTCGTCATCGTCAGCGGAGCCAACACCGGTGAGGATTCGCAGGAAGAGGCATCTGAACTGTTCTCTCTGACGTCT
GGTAGGCCTCGGTCGCGAAGCAGCTCGCCACTTCACCCGCCTCAATGCTGCCAAAGTGATTCTCGCCTGTCGCAA
TGTCGACAAGGCTGAAGCCGCGAGACGCGACATTGAGGTGACGACGGGCCGCTCTGGCGTCGTCGAGTCTTGGCA
GCTCGATCTCTCCGCTGTGGATAGCGTCAAGGCCTTTACCGACCGCGCGGCTGCGCTTGATCGGCTGGATATCCT
CGTCAATAATGCCAGCGTCTTGTCCATAGAATGGTCCTTGGCCGATGGGCACGAGACTATGGTTACCGTCAACGT
CATCTCGACTTTTCTACTGACGCTGCGGCTTCTGCCTGTGATGCGGCGCACCGCTATGCGATTCAACGTGACGCC
TCACGTTGTCATTGTCTCGTCTGATGCCTCCTTCTTGGTGCGTATCTGTAATTGGGATCCCCAAGCTGCATGATG
CTGACGACGACGGCCAAGACTTCCTTTCCCGAACGGCACGCGGAGAACATCATCCAGCGGCTTCAGCTCAATCAA
CAGTATCAAGATCGCTACAACGTCACCAAGCTGCTGCAGCTGATGGCAACACGCGAACTCGCCCGCGCCTGTGAC
GCCTCAGCAAAGAGCAACGTCATCATCAACGCACTCAATCCAGGCTTCTGCGATACAGAACTGTTTCGCGCCGTG
CCCGCTCCCTTTAGCCTCGTCATTCGCTTTGGCTTGGCCATCTTCGGACGCACCCCGGAGATGGGCTCGCGTACA
CTCATGTCTGCTGCCTTTGCTGGCCATGACACTCACGGCCGCTACATGACCAACTGCCGTATGCATAGTTGGCCG
TCGCTCATCGATGGCGCTGAAGGGGAGCGTCTTTGTCAACGGTTTTGGCGTGAGCTGGTTCAGGTGCTCGACGAT
ATAGACCCGGATGTCTCCAAGAATATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail