Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4591
Gene name
LocationContig_427:1041..3033
Strand-
Gene length (bp)1992
Transcript length (bp)1872
Coding sequence length (bp)1872
Protein length (aa) 624

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 2.3E-11 10 55
PF00646 F-box F-box domain 1.2E-07 10 51

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3137
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6004
Ophiocordyceps australis map64 (Brazil) OphauB2|4446
Ophiocordyceps camponoti-floridani Ophcf2|03357
Ophiocordyceps camponoti-rufipedis Ophun1|4591 (this protein)
Ophiocordyceps kimflemingae Ophio5|50
Ophiocordyceps subramaniannii Hirsu2|5513

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4591
MAWDRRPLPWDELPDEILLQILRYLEPCQINKLHLVSRKLRKLSLDEELWKRLCFQDSPWYRSLQNRRAAQEKSV
QLVNHLPLLDSSRTAVHPRVRHEPETSWQRRQDLANWDPTYPGEKVSWYEEYIQRQGPVSVNWLQMPRKCGRGNE
PVVEARGVALYSPHGGRDGLGTMLAVSPLEDGSICLWDVNGNRASQGSIVARSRPGSLFANEPNGTSNRRSRKVD
ADVIECVSVSDSGHRAFFAVQSHLVEVDLNRLDVVSRESFEWSITAMSAVQDGVPLTVGTSLGIHLHDFRARART
GHDVVDRLDGPRADAAHPFKAIFDPNPLPPYAPLSQPTPISILHLPRQGAPHLASDDIYVSGRFSNILHYDRRKF
PSIAGSIYSGALIKSLTSLPVSFSALDAELRRKAELSAESVAQTKTAVQGQTLIAGGGYNTKGSLEMYGLVTAGD
SSSYGMLQNSALKNRQTAASATILSVINHGTKLAFSDGTGLLKWFERDGTTECRRLRIGHSDSEDEDSLFASMPA
SDDLARKILSTRPREGSERLNDDNILFWTGERLGMVTFTARPRFDDKQFGPRDSSAAAEEEEDDRRRRIYGERMR
RALDRQADEVRFMGNLGMGMGAR*
Coding >Ophun1|4591
ATGGCCTGGGATCGCAGGCCTCTGCCGTGGGACGAGCTGCCAGACGAGATCCTCCTCCAGATACTACGCTATCTC
GAGCCATGTCAAATAAATAAACTGCACTTGGTGTCGCGCAAGCTCCGCAAGCTCTCTCTCGACGAAGAGCTGTGG
AAGCGGCTATGCTTCCAAGACTCGCCATGGTATCGCTCGCTGCAGAACCGTCGTGCCGCGCAAGAGAAATCAGTC
CAGCTGGTAAACCACCTGCCGCTGCTGGACTCGAGCCGCACCGCCGTCCATCCCAGGGTGCGCCATGAGCCTGAG
ACGAGTTGGCAACGGCGGCAAGACCTGGCCAACTGGGATCCTACTTATCCGGGAGAAAAGGTCTCATGGTACGAG
GAATACATCCAACGTCAGGGACCCGTTAGCGTCAACTGGCTGCAGATGCCGCGGAAATGCGGTCGAGGCAACGAG
CCCGTGGTGGAAGCCCGCGGCGTCGCGCTGTACAGCCCCCATGGCGGGAGAGACGGTCTCGGCACCATGCTCGCA
GTCTCTCCTCTGGAAGACGGGTCCATCTGTCTGTGGGACGTCAACGGGAATCGAGCAAGCCAAGGCAGCATCGTT
GCGAGAAGCCGTCCGGGCAGCCTCTTCGCCAACGAGCCCAACGGAACCAGCAACCGGCGCTCTCGGAAGGTCGAC
GCCGACGTGATAGAATGCGTCAGTGTAAGCGATAGCGGTCATCGGGCCTTTTTCGCCGTCCAGAGTCACCTCGTC
GAAGTCGACCTGAACCGCCTGGACGTGGTGAGCCGAGAGTCGTTTGAGTGGTCCATCACTGCCATGTCTGCCGTC
CAGGATGGCGTGCCTCTGACGGTGGGCACATCATTGGGTATTCACCTACACGATTTCCGCGCCAGGGCCAGGACG
GGACACGACGTGGTGGATCGACTCGACGGCCCTCGAGCGGATGCGGCACATCCCTTCAAGGCCATCTTTGATCCC
AATCCGTTGCCGCCGTACGCTCCGCTATCCCAGCCGACTCCCATCAGCATACTCCATCTTCCCCGGCAAGGAGCG
CCGCATCTGGCATCGGACGATATATACGTGTCAGGACGCTTCTCCAACATCCTGCACTACGACCGACGCAAGTTT
CCGTCCATTGCCGGGTCCATCTACTCCGGGGCGCTGATCAAGAGCCTCACGAGCCTGCCCGTGTCCTTTTCGGCC
CTGGACGCGGAGCTGCGGCGGAAAGCGGAGCTCAGCGCGGAGAGCGTGGCGCAGACTAAGACGGCTGTGCAGGGA
CAGACGCTGATCGCGGGCGGAGGCTACAACACCAAGGGATCGCTCGAGATGTACGGACTTGTCACGGCGGGCGAC
TCTTCGAGCTACGGGATGCTGCAGAACTCGGCCTTGAAGAACCGGCAGACGGCGGCGTCGGCGACGATCCTTTCC
GTCATCAACCACGGCACCAAGCTGGCCTTTTCCGACGGCACGGGGCTTCTCAAGTGGTTCGAGCGGGACGGTACG
ACGGAATGCCGACGGCTGAGGATCGGACACAGCGACTCGGAGGACGAAGACTCGCTCTTTGCGTCGATGCCGGCG
TCGGACGACTTGGCGCGCAAGATTCTATCGACGCGGCCGAGAGAGGGCTCGGAGCGGCTCAACGATGACAACATT
CTGTTCTGGACGGGAGAGAGGCTGGGCATGGTTACGTTTACGGCACGGCCGCGCTTCGACGACAAGCAGTTTGGG
CCGAGGGACTCGTCTGCTGCGGCGGAGGAGGAAGAGGACGACAGGAGGCGACGGATCTATGGGGAACGGATGCGG
CGGGCTCTGGATCGGCAGGCGGACGAGGTCAGGTTTATGGGGAACCTGGGGATGGGGATGGGGGCTCGTTAG
Transcript >Ophun1|4591
ATGGCCTGGGATCGCAGGCCTCTGCCGTGGGACGAGCTGCCAGACGAGATCCTCCTCCAGATACTACGCTATCTC
GAGCCATGTCAAATAAATAAACTGCACTTGGTGTCGCGCAAGCTCCGCAAGCTCTCTCTCGACGAAGAGCTGTGG
AAGCGGCTATGCTTCCAAGACTCGCCATGGTATCGCTCGCTGCAGAACCGTCGTGCCGCGCAAGAGAAATCAGTC
CAGCTGGTAAACCACCTGCCGCTGCTGGACTCGAGCCGCACCGCCGTCCATCCCAGGGTGCGCCATGAGCCTGAG
ACGAGTTGGCAACGGCGGCAAGACCTGGCCAACTGGGATCCTACTTATCCGGGAGAAAAGGTCTCATGGTACGAG
GAATACATCCAACGTCAGGGACCCGTTAGCGTCAACTGGCTGCAGATGCCGCGGAAATGCGGTCGAGGCAACGAG
CCCGTGGTGGAAGCCCGCGGCGTCGCGCTGTACAGCCCCCATGGCGGGAGAGACGGTCTCGGCACCATGCTCGCA
GTCTCTCCTCTGGAAGACGGGTCCATCTGTCTGTGGGACGTCAACGGGAATCGAGCAAGCCAAGGCAGCATCGTT
GCGAGAAGCCGTCCGGGCAGCCTCTTCGCCAACGAGCCCAACGGAACCAGCAACCGGCGCTCTCGGAAGGTCGAC
GCCGACGTGATAGAATGCGTCAGTGTAAGCGATAGCGGTCATCGGGCCTTTTTCGCCGTCCAGAGTCACCTCGTC
GAAGTCGACCTGAACCGCCTGGACGTGGTGAGCCGAGAGTCGTTTGAGTGGTCCATCACTGCCATGTCTGCCGTC
CAGGATGGCGTGCCTCTGACGGTGGGCACATCATTGGGTATTCACCTACACGATTTCCGCGCCAGGGCCAGGACG
GGACACGACGTGGTGGATCGACTCGACGGCCCTCGAGCGGATGCGGCACATCCCTTCAAGGCCATCTTTGATCCC
AATCCGTTGCCGCCGTACGCTCCGCTATCCCAGCCGACTCCCATCAGCATACTCCATCTTCCCCGGCAAGGAGCG
CCGCATCTGGCATCGGACGATATATACGTGTCAGGACGCTTCTCCAACATCCTGCACTACGACCGACGCAAGTTT
CCGTCCATTGCCGGGTCCATCTACTCCGGGGCGCTGATCAAGAGCCTCACGAGCCTGCCCGTGTCCTTTTCGGCC
CTGGACGCGGAGCTGCGGCGGAAAGCGGAGCTCAGCGCGGAGAGCGTGGCGCAGACTAAGACGGCTGTGCAGGGA
CAGACGCTGATCGCGGGCGGAGGCTACAACACCAAGGGATCGCTCGAGATGTACGGACTTGTCACGGCGGGCGAC
TCTTCGAGCTACGGGATGCTGCAGAACTCGGCCTTGAAGAACCGGCAGACGGCGGCGTCGGCGACGATCCTTTCC
GTCATCAACCACGGCACCAAGCTGGCCTTTTCCGACGGCACGGGGCTTCTCAAGTGGTTCGAGCGGGACGGTACG
ACGGAATGCCGACGGCTGAGGATCGGACACAGCGACTCGGAGGACGAAGACTCGCTCTTTGCGTCGATGCCGGCG
TCGGACGACTTGGCGCGCAAGATTCTATCGACGCGGCCGAGAGAGGGCTCGGAGCGGCTCAACGATGACAACATT
CTGTTCTGGACGGGAGAGAGGCTGGGCATGGTTACGTTTACGGCACGGCCGCGCTTCGACGACAAGCAGTTTGGG
CCGAGGGACTCGTCTGCTGCGGCGGAGGAGGAAGAGGACGACAGGAGGCGACGGATCTATGGGGAACGGATGCGG
CGGGCTCTGGATCGGCAGGCGGACGAGGTCAGGTTTATGGGGAACCTGGGGATGGGGATGGGGGCTCGTTAG
Gene >Ophun1|4591
ATGGCCTGGGATCGCAGGCCTCTGCCGTGGGACGAGCTGCCAGACGAGATCCTCCTCCAGATACTACGCTGTGAG
CCGCTTCGTCTCATCTCTCCTTGCCCTCCGGGACCCTGACAGCCGCTACCGCCTCTAGATCTCGAGCCATGTCAA
ATAAATAAACTGCACTTGGTGTCGCGCAAGCTCCGCAAGCTCTCTCTCGACGAAGAGCTGTGGAAGCGGCTATGC
TTCCAAGACTCGCCATGGTATCGCTCGCTGCAGAACCGTCGTGCCGCGCAAGAGAAATCAGTCCAGCTGGTAAAC
CACCTGCCGCTGCTGGACTCGAGCCGCACCGCCGTCCATCCCAGGGTGCGCCATGAGCCTGAGACGAGTTGGCAA
CGGCGGCAAGACCTGGCCAACTGGGATCCTACTTATCCGGGAGAAAAGGTCTCATGGTACGAGGAATACATCCAA
CGTCAGGGACCCGTTAGCGTCAACTGGCTGCAGATGCCGCGGAAATGCGGTCGAGGCAACGAGCCCGTGGTGGAA
GCCCGCGGCGTCGCGCTGTACAGCCCCCATGGCGGGAGAGACGGTCTCGGCACCATGCTCGCAGTCTCTCCTCTG
GAAGACGGGTCCATCTGTCTGTGGGACGTCAACGGGAATCGAGCAAGCCAAGGCAGCATCGTTGCGAGAAGCCGT
CCGGGCAGCCTCTTCGCCAACGAGCCCAACGGAACCAGCAACCGGCGCTCTCGGAAGGTCGACGCCGACGTGATA
GAATGCGTCAGTGTAAGCGATAGCGGTCATCGGGCCTTTTTCGCCGTCCAGAGTCGTGAGTCGAACCCCCTGAAG
TGGCAGACGTACTCCGCCCCCTTACACTGGACCGCAGACCTCGTCGAAGTCGACCTGAACCGCCTGGACGTGGTG
AGCCGAGAGTCGTTTGAGTGGTCCATCACTGCCATGTCTGCCGTCCAGGATGGCGTGCCTCTGACGGTGGGCACA
TCATTGGGTATTCACCTACACGATTTCCGCGCCAGGGCCAGGACGGGACACGACGTGGTGGATCGACTCGACGGC
CCTCGAGCGGATGCGGCACATCCCTTCAAGGCCATCTTTGATCCCAATCCGTTGCCGCCGTACGCTCCGCTATCC
CAGCCGACTCCCATCAGCATACTCCATCTTCCCCGGCAAGGAGCGCCGCATCTGGCATCGGACGATATATACGTG
TCAGGACGCTTCTCCAACATCCTGCACTACGACCGACGCAAGTTTCCGTCCATTGCCGGGTCCATCTACTCCGGG
GCGCTGATCAAGAGCCTCACGAGCCTGCCCGTGTCCTTTTCGGCCCTGGACGCGGAGCTGCGGCGGAAAGCGGAG
CTCAGCGCGGAGAGCGTGGCGCAGACTAAGACGGCTGTGCAGGGACAGACGCTGATCGCGGGCGGAGGCTACAAC
ACCAAGGGATCGCTCGAGATGTACGGACTTGTCACGGCGGGCGACTCTTCGAGCTACGGGATGCTGCAGAACTCG
GCCTTGAAGAACCGGCAGACGGCGGCGTCGGCGACGATCCTTTCCGTCATCAACCACGGCACCAAGCTGGCCTTT
TCCGACGGCACGGGGCTTCTCAAGTGGTTCGAGCGGGACGGTACGACGGAATGCCGACGGCTGAGGATCGGACAC
AGCGACTCGGAGGACGAAGACTCGCTCTTTGCGTCGATGCCGGCGTCGGACGACTTGGCGCGCAAGATTCTATCG
ACGCGGCCGAGAGAGGGCTCGGAGCGGCTCAACGATGACAACATTCTGTTCTGGACGGGAGAGAGGCTGGGCATG
GTTACGTTTACGGCACGGCCGCGCTTCGACGACAAGCAGTTTGGGCCGAGGGACTCGTCTGCTGCGGCGGAGGAG
GAAGAGGACGACAGGAGGCGACGGATCTATGGGGAACGGATGCGGCGGGCTCTGGATCGGCAGGCGGACGAGGTC
AGGTTTATGGGGAACCTGGGGATGGGGATGGGGGCTCGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail