Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4577
Gene name
LocationContig_425:8559..9300
Strand-
Gene length (bp)741
Transcript length (bp)741
Coding sequence length (bp)741
Protein length (aa) 247

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 2.2E-07 65 172
PF08242 Methyltransf_12 Methyltransferase domain 2.6E-07 65 173
PF08241 Methyltransf_11 Methyltransferase domain 5.0E-05 65 174

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P77460|YBCY_ECOLI Putative uncharacterized protein YbcY OS=Escherichia coli (strain K12) GN=ybcY PE=5 SV=2 37 241 9.0E-29

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4577
MAPQHQQLPQARPDSSAGAAIYTPWFLKIYDFLLLRLANPLIWNFPAEQELIPLLKSALIGSRHLDIGVGTGFYP
AKALASTDRSACEHMTLVDLNPNALTLAARTIRTASRGEISVTTIQADILAPPLPPSVGGNYDSISLFYLIHCLP
GPSDAKIRAVADAVAPLLAAGGTVVGATILGRGKRLGWFPTLFRLLLNWLGVFGNLGDEEEVLVGGLRRRFREVV
VWQVGAVMMFRARGAKSDGDL*
Coding >Ophun1|4577
ATGGCTCCTCAACATCAACAGCTCCCACAAGCACGCCCAGACTCATCCGCAGGCGCAGCAATCTACACGCCATGG
TTCCTCAAAATCTACGACTTCCTCCTCCTCCGCCTCGCCAACCCGCTGATATGGAACTTCCCCGCCGAACAAGAG
CTCATCCCCCTCCTGAAATCCGCCCTCATCGGCAGCCGTCATCTCGACATTGGCGTCGGAACGGGCTTCTACCCT
GCCAAGGCCCTCGCCTCTACCGACCGCTCCGCCTGCGAGCACATGACGCTCGTAGATCTCAACCCCAACGCCCTC
ACCCTCGCCGCCCGGACCATCCGCACCGCCTCAAGGGGGGAAATCTCAGTAACCACCATCCAAGCCGACATCCTC
GCCCCGCCGCTCCCGCCCAGCGTGGGGGGGAACTACGACTCCATCAGCCTCTTCTACCTCATCCACTGCCTGCCC
GGCCCCTCGGACGCCAAGATCCGGGCGGTGGCGGACGCGGTGGCTCCGCTGCTGGCTGCGGGGGGGACGGTGGTT
GGCGCGACGATTCTGGGGCGGGGGAAGCGGCTGGGTTGGTTCCCTACGCTCTTTAGGCTCTTGCTCAACTGGCTG
GGGGTTTTTGGCAATTTGGGGGATGAGGAGGAGGTTTTGGTTGGGGGGTTGAGGAGGAGGTTTCGGGAGGTTGTG
GTTTGGCAGGTTGGGGCTGTTATGATGTTTCGGGCGAGGGGGGCCAAGTCTGATGGGGATCTTTGA
Transcript >Ophun1|4577
ATGGCTCCTCAACATCAACAGCTCCCACAAGCACGCCCAGACTCATCCGCAGGCGCAGCAATCTACACGCCATGG
TTCCTCAAAATCTACGACTTCCTCCTCCTCCGCCTCGCCAACCCGCTGATATGGAACTTCCCCGCCGAACAAGAG
CTCATCCCCCTCCTGAAATCCGCCCTCATCGGCAGCCGTCATCTCGACATTGGCGTCGGAACGGGCTTCTACCCT
GCCAAGGCCCTCGCCTCTACCGACCGCTCCGCCTGCGAGCACATGACGCTCGTAGATCTCAACCCCAACGCCCTC
ACCCTCGCCGCCCGGACCATCCGCACCGCCTCAAGGGGGGAAATCTCAGTAACCACCATCCAAGCCGACATCCTC
GCCCCGCCGCTCCCGCCCAGCGTGGGGGGGAACTACGACTCCATCAGCCTCTTCTACCTCATCCACTGCCTGCCC
GGCCCCTCGGACGCCAAGATCCGGGCGGTGGCGGACGCGGTGGCTCCGCTGCTGGCTGCGGGGGGGACGGTGGTT
GGCGCGACGATTCTGGGGCGGGGGAAGCGGCTGGGTTGGTTCCCTACGCTCTTTAGGCTCTTGCTCAACTGGCTG
GGGGTTTTTGGCAATTTGGGGGATGAGGAGGAGGTTTTGGTTGGGGGGTTGAGGAGGAGGTTTCGGGAGGTTGTG
GTTTGGCAGGTTGGGGCTGTTATGATGTTTCGGGCGAGGGGGGCCAAGTCTGATGGGGATCTTTGA
Gene >Ophun1|4577
ATGGCTCCTCAACATCAACAGCTCCCACAAGCACGCCCAGACTCATCCGCAGGCGCAGCAATCTACACGCCATGG
TTCCTCAAAATCTACGACTTCCTCCTCCTCCGCCTCGCCAACCCGCTGATATGGAACTTCCCCGCCGAACAAGAG
CTCATCCCCCTCCTGAAATCCGCCCTCATCGGCAGCCGTCATCTCGACATTGGCGTCGGAACGGGCTTCTACCCT
GCCAAGGCCCTCGCCTCTACCGACCGCTCCGCCTGCGAGCACATGACGCTCGTAGATCTCAACCCCAACGCCCTC
ACCCTCGCCGCCCGGACCATCCGCACCGCCTCAAGGGGGGAAATCTCAGTAACCACCATCCAAGCCGACATCCTC
GCCCCGCCGCTCCCGCCCAGCGTGGGGGGGAACTACGACTCCATCAGCCTCTTCTACCTCATCCACTGCCTGCCC
GGCCCCTCGGACGCCAAGATCCGGGCGGTGGCGGACGCGGTGGCTCCGCTGCTGGCTGCGGGGGGGACGGTGGTT
GGCGCGACGATTCTGGGGCGGGGGAAGCGGCTGGGTTGGTTCCCTACGCTCTTTAGGCTCTTGCTCAACTGGCTG
GGGGTTTTTGGCAATTTGGGGGATGAGGAGGAGGTTTTGGTTGGGGGGTTGAGGAGGAGGTTTCGGGAGGTTGTG
GTTTGGCAGGTTGGGGCTGTTATGATGTTTCGGGCGAGGGGGGCCAAGTCTGATGGGGATCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail