Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4568
Gene name
LocationContig_424:2209..4171
Strand-
Gene length (bp)1962
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03467 Smg4_UPF3 Smg-4/UPF3 family 5.1E-47 59 229
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 8.9E-06 479 522

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9FVW4|RENT3_ARATH Regulator of nonsense transcripts UPF3 OS=Arabidopsis thaliana GN=UPF3 PE=1 SV=1 55 229 2.0E-14
sp|O94260|G3BP_SCHPO Putative G3BP-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nxt3 PE=1 SV=1 431 564 2.0E-08
sp|Q10267|UPF3_SCHPO Nonsense-mediated mRNA decay protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf3 PE=3 SV=1 52 228 3.0E-08
sp|Q9H1J1|REN3A_HUMAN Regulator of nonsense transcripts 3A OS=Homo sapiens GN=UPF3A PE=1 SV=1 62 233 2.0E-07
sp|B0S733|REN3A_DANRE Regulator of nonsense transcripts 3A OS=Danio rerio GN=upf3a PE=2 SV=2 62 231 5.0E-06

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4568
MSASPALSRRTDGPLPPDKGKSSHHVHPQRPSRGAEKASDSVKSSGEPSKRTKSRSPSQGEKLIIRRLPPGMTEA
EFVAILGSDWEVNKGKVDWFSFCPGKVSVDPSKQSRPGRAYLHLTRKDDMMALSQVVRAATWEDAKLTFTSPALV
GPPSLEFATYKKIPSTRRRGDPRQGTIDQDPEFMAFLEGLANPVPYKESVDVEDADDGNKDDGKITTTPLIEYLR
EKKANKGKETAKNAKGKAAAREDDKKKTRDAKGDKSVKTAAKEPVKILMKKAAAEPAPEVVASPVPPVSAVADAP
KGRRAGIAAAARILQRDLGLSPGSAHRRARHDAAKAEAASSKEAVGEAAPPPSTTEAASSKITVATKQPQAPGRR
VRSGKAAERGKAAEGQQTTATTPVTATVSNPPVMLRKRGDEEVPLATTTIRPATSKPAANGKATGPSASNTNKGG
KATGGQQKKAPTVTAGATRAFVKHANASQGVTEASLRQALEAFGAVTQVEVDKRKGFAYVDFADHDGLVKAMGAG
TVQVAQSAVQVVERRDKKPATGGGPEKGAGRGRRGRGGGGGGGGAKANGTAPAAVAATTGGSG*
Coding >Ophun1|4568
ATGTCCGCGTCACCGGCGCTGTCCCGTAGGACCGATGGTCCGCTCCCTCCGGACAAGGGAAAGTCGTCTCACCAT
GTCCATCCGCAGCGACCGTCTCGTGGGGCGGAAAAGGCTTCGGATTCTGTCAAGAGCTCCGGTGAGCCGTCGAAA
CGAACAAAGTCTAGATCTCCCAGTCAGGGAGAAAAACTCATCATCCGCCGCCTGCCCCCGGGCATGACCGAGGCC
GAATTCGTCGCTATTCTCGGCTCCGACTGGGAGGTGAACAAGGGCAAGGTCGACTGGTTCTCCTTTTGCCCCGGA
AAAGTCTCTGTCGATCCTTCGAAGCAGTCTCGCCCGGGCAGGGCCTATCTTCATCTCACGCGAAAAGACGACATG
ATGGCTCTCAGCCAGGTCGTGCGCGCCGCCACGTGGGAAGACGCCAAGTTGACGTTTACGAGCCCCGCGCTCGTT
GGCCCGCCAAGCCTCGAGTTTGCGACGTACAAGAAGATACCCAGCACCCGCCGGCGAGGCGACCCTCGTCAGGGC
ACCATCGATCAAGACCCCGAGTTCATGGCTTTCCTCGAAGGCCTCGCAAACCCGGTCCCTTACAAGGAGAGCGTT
GATGTTGAAGACGCCGACGACGGAAACAAGGATGACGGCAAGATAACAACGACGCCGCTCATCGAGTATCTCCGT
GAGAAAAAGGCCAACAAGGGCAAGGAGACTGCCAAAAACGCCAAGGGCAAGGCAGCTGCTAGAGAAGACGACAAG
AAGAAGACGAGAGACGCAAAAGGCGACAAATCGGTCAAGACGGCAGCCAAAGAGCCCGTCAAGATTTTGATGAAG
AAGGCCGCAGCTGAGCCAGCCCCCGAGGTGGTGGCCAGTCCAGTGCCGCCTGTCAGCGCCGTAGCCGACGCTCCC
AAAGGTCGTCGCGCCGGCATAGCGGCCGCCGCGCGCATCCTGCAGCGCGACCTCGGCTTGAGCCCGGGCAGCGCC
CACCGACGAGCAAGACACGACGCCGCCAAAGCAGAGGCAGCTTCGAGCAAGGAAGCTGTCGGAGAAGCTGCACCG
CCACCGTCGACGACGGAAGCCGCCAGCAGCAAAATTACAGTCGCGACCAAGCAGCCGCAGGCGCCGGGCCGTAGG
GTTCGCAGCGGCAAGGCAGCCGAAAGGGGCAAGGCAGCCGAAGGCCAGCAGACGACAGCGACGACGCCTGTGACG
GCAACGGTCAGCAACCCGCCGGTGATGCTCAGGAAGAGAGGCGACGAGGAGGTACCGCTTGCGACGACGACGATC
CGGCCGGCCACGAGCAAACCGGCCGCCAATGGAAAGGCTACTGGGCCGTCTGCGAGCAACACCAACAAGGGCGGC
AAGGCCACGGGTGGTCAGCAGAAGAAGGCGCCGACGGTGACGGCGGGTGCGACTCGAGCCTTTGTCAAGCACGCC
AACGCATCGCAGGGGGTAACGGAAGCATCGCTGCGGCAGGCACTGGAGGCGTTTGGGGCGGTGACGCAGGTCGAG
GTGGACAAGCGCAAGGGCTTCGCCTACGTCGACTTTGCCGATCACGACGGGCTCGTCAAGGCCATGGGCGCGGGA
ACCGTGCAGGTGGCCCAGAGCGCGGTGCAGGTGGTGGAGCGGCGGGACAAGAAGCCGGCGACGGGAGGCGGGCCG
GAGAAGGGAGCGGGACGGGGCCGGCGCGGGCGTGGAGGCGGAGGCGGAGGCGGAGGTGCCAAGGCCAACGGCACG
GCTCCGGCGGCGGTGGCAGCGACTACGGGGGGATCCGGATGA
Transcript >Ophun1|4568
ATGTCCGCGTCACCGGCGCTGTCCCGTAGGACCGATGGTCCGCTCCCTCCGGACAAGGGAAAGTCGTCTCACCAT
GTCCATCCGCAGCGACCGTCTCGTGGGGCGGAAAAGGCTTCGGATTCTGTCAAGAGCTCCGGTGAGCCGTCGAAA
CGAACAAAGTCTAGATCTCCCAGTCAGGGAGAAAAACTCATCATCCGCCGCCTGCCCCCGGGCATGACCGAGGCC
GAATTCGTCGCTATTCTCGGCTCCGACTGGGAGGTGAACAAGGGCAAGGTCGACTGGTTCTCCTTTTGCCCCGGA
AAAGTCTCTGTCGATCCTTCGAAGCAGTCTCGCCCGGGCAGGGCCTATCTTCATCTCACGCGAAAAGACGACATG
ATGGCTCTCAGCCAGGTCGTGCGCGCCGCCACGTGGGAAGACGCCAAGTTGACGTTTACGAGCCCCGCGCTCGTT
GGCCCGCCAAGCCTCGAGTTTGCGACGTACAAGAAGATACCCAGCACCCGCCGGCGAGGCGACCCTCGTCAGGGC
ACCATCGATCAAGACCCCGAGTTCATGGCTTTCCTCGAAGGCCTCGCAAACCCGGTCCCTTACAAGGAGAGCGTT
GATGTTGAAGACGCCGACGACGGAAACAAGGATGACGGCAAGATAACAACGACGCCGCTCATCGAGTATCTCCGT
GAGAAAAAGGCCAACAAGGGCAAGGAGACTGCCAAAAACGCCAAGGGCAAGGCAGCTGCTAGAGAAGACGACAAG
AAGAAGACGAGAGACGCAAAAGGCGACAAATCGGTCAAGACGGCAGCCAAAGAGCCCGTCAAGATTTTGATGAAG
AAGGCCGCAGCTGAGCCAGCCCCCGAGGTGGTGGCCAGTCCAGTGCCGCCTGTCAGCGCCGTAGCCGACGCTCCC
AAAGGTCGTCGCGCCGGCATAGCGGCCGCCGCGCGCATCCTGCAGCGCGACCTCGGCTTGAGCCCGGGCAGCGCC
CACCGACGAGCAAGACACGACGCCGCCAAAGCAGAGGCAGCTTCGAGCAAGGAAGCTGTCGGAGAAGCTGCACCG
CCACCGTCGACGACGGAAGCCGCCAGCAGCAAAATTACAGTCGCGACCAAGCAGCCGCAGGCGCCGGGCCGTAGG
GTTCGCAGCGGCAAGGCAGCCGAAAGGGGCAAGGCAGCCGAAGGCCAGCAGACGACAGCGACGACGCCTGTGACG
GCAACGGTCAGCAACCCGCCGGTGATGCTCAGGAAGAGAGGCGACGAGGAGGTACCGCTTGCGACGACGACGATC
CGGCCGGCCACGAGCAAACCGGCCGCCAATGGAAAGGCTACTGGGCCGTCTGCGAGCAACACCAACAAGGGCGGC
AAGGCCACGGGTGGTCAGCAGAAGAAGGCGCCGACGGTGACGGCGGGTGCGACTCGAGCCTTTGTCAAGCACGCC
AACGCATCGCAGGGGGTAACGGAAGCATCGCTGCGGCAGGCACTGGAGGCGTTTGGGGCGGTGACGCAGGTCGAG
GTGGACAAGCGCAAGGGCTTCGCCTACGTCGACTTTGCCGATCACGACGGGCTCGTCAAGGCCATGGGCGCGGGA
ACCGTGCAGGTGGCCCAGAGCGCGGTGCAGGTGGTGGAGCGGCGGGACAAGAAGCCGGCGACGGGAGGCGGGCCG
GAGAAGGGAGCGGGACGGGGCCGGCGCGGGCGTGGAGGCGGAGGCGGAGGCGGAGGTGCCAAGGCCAACGGCACG
GCTCCGGCGGCGGTGGCAGCGACTACGGGGGGATCCGGATGA
Gene >Ophun1|4568
ATGTCCGCGTCACCGGCGCTGTCCCGTAGGACCGATGGTCCGCTCCCTCCGGACAAGGTGAGAGAGGCACAACTT
GACAAGGCAGCGCGCCGCCTCGCTTTTTCTGACGGCCATGTCTCCAGGGAAAGTCGTCTCACCATGTCCATCCGC
AGCGACCGTCTCGTGGGGCGGAAAAGGCTTCGGATTCTGTCAAGGTGAGCTCGCGGTTGCTTCCATCTGCCCGTG
TCTGGGCTGACGCCTCGGTGTGCAGAGCTCCGGTGAGCCGTCGAAACGAACAAAGTCTAGATCTCCCAGTCAGGG
AGAAAAACTCATCATCCGCCGCCTGCCCCCGGGCATGACCGAGGCCGAATTCGTCGCTATTCTCGGCTCCGACTG
GGAGGTGAACAAGGGCAAGGTCGACTGGTTCTCCTTTTGCCCCGGAAAAGTCTCTGTCGAGTTCGTCCTCGTGCG
CCCCGTGCTGCTGATGGTGCCAAGGCACGAGCACCCGGCACTGACGATTCTCGCCCCAGTCCTTCGAAGCAGTCT
CGCCCGGGCAGGGCCTATCTTCATCTCACGCGAAAAGACGACATGATGGCTCTCAGCCAGGTCGTGCGCGCCGCC
ACGTGGGAAGACGCCAAGTTGACGTTTACGAGCCCCGCGCTCGTTGGCCCGCCAAGCCTCGAGTTTGCGACGTAC
AAGAAGATACCCAGCACCCGCCGGCGAGGCGACCCTCGTCAGGGCACCATCGATCAAGACCCCGAGTTCATGGCT
TTCCTCGAAGGCCTCGCAAACCCGGTCCCTTACAAGGAGAGCGTTGATGTTGAAGACGCCGACGACGGAAACAAG
GATGACGGCAAGATAACAACGACGCCGCTCATCGAGTATCTCCGTGAGAAAAAGGCCAACAAGGGCAAGGAGACT
GCCAAAAACGCCAAGGGCAAGGCAGCTGCTAGAGAAGACGACAAGAAGAAGACGAGAGACGCAAAAGGCGACAAA
TCGGTCAAGACGGCAGCCAAAGAGCCCGTCAAGATTTTGATGAAGAAGGCCGCAGCTGAGCCAGCCCCCGAGGTG
GTGGCCAGTCCAGTGCCGCCTGTCAGCGCCGTAGCCGACGCTCCCAAAGGTCGTCGCGCCGGCATAGCGGCCGCC
GCGCGCATCCTGCAGCGCGACCTCGGCTTGAGCCCGGGCAGCGCCCACCGACGAGCAAGACACGACGCCGCCAAA
GCAGAGGCAGCTTCGAGCAAGGAAGCTGTCGGAGAAGCTGCACCGCCACCGTCGACGACGGAAGCCGCCAGCAGC
AAAATTACAGTCGCGACCAAGCAGCCGCAGGCGCCGGGCCGTAGGGTTCGCAGCGGCAAGGCAGCCGAAAGGGGC
AAGGCAGCCGAAGGCCAGCAGACGACAGCGACGACGCCTGTGACGGCAACGGTCAGCAACCCGCCGGTGATGCTC
AGGAAGAGAGGCGACGAGGAGGTACCGCTTGCGACGACGACGATCCGGCCGGCCACGAGCAAACCGGCCGCCAAT
GGAAAGGCTACTGGGCCGTCTGCGAGCAACACCAACAAGGGCGGCAAGGCCACGGGTGGTCAGCAGAAGAAGGCG
CCGACGGTGACGGCGGGTGCGACTCGAGCCTTTGTCAAGCACGCCAACGCATCGCAGGGGGTAACGGAAGCATCG
CTGCGGCAGGCACTGGAGGCGTTTGGGGCGGTGACGCAGGTCGAGGTGGACAAGCGCAAGGGCTTCGCCTACGTC
GACTTTGCCGATCACGACGGGCTCGTCAAGGCCATGGGCGCGGGAACCGTGCAGGTGGCCCAGAGCGCGGTGCAG
GTGGTGGAGCGGCGGGACAAGAAGCCGGCGACGGGAGGCGGGCCGGAGAAGGGAGCGGGACGGGGCCGGCGCGGG
CGTGGAGGCGGAGGCGGAGGCGGAGGTGCCAAGGCCAACGGCACGGCTCCGGCGGCGGTGGCAGCGACTACGGGG
GGATCCGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail