Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|456
Gene name
LocationContig_113:4162..4774
Strand+
Gene length (bp)612
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01521 Fe-S_biosyn Iron-sulphur cluster biosynthesis 2.0E-16 104 201

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07821|ISA1_YEAST Iron-sulfur assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISA1 PE=1 SV=1 102 194 6.0E-41
sp|P78859|ISA1_SCHPO Iron-sulfur assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isa1 PE=2 SV=1 76 195 2.0E-32
sp|Q5ZJ74|ISCA1_CHICK Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Gallus gallus GN=ISCA1 PE=2 SV=1 96 195 4.0E-32
sp|Q4R5F0|ISCA1_MACFA Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Macaca fascicularis GN=ISCA1 PE=2 SV=1 96 195 6.0E-32
sp|Q9BUE6|ISCA1_HUMAN Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Homo sapiens GN=ISCA1 PE=1 SV=1 96 195 6.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07821|ISA1_YEAST Iron-sulfur assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISA1 PE=1 SV=1 102 194 6.0E-41
sp|P78859|ISA1_SCHPO Iron-sulfur assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isa1 PE=2 SV=1 76 195 2.0E-32
sp|Q5ZJ74|ISCA1_CHICK Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Gallus gallus GN=ISCA1 PE=2 SV=1 96 195 4.0E-32
sp|Q4R5F0|ISCA1_MACFA Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Macaca fascicularis GN=ISCA1 PE=2 SV=1 96 195 6.0E-32
sp|Q9BUE6|ISCA1_HUMAN Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Homo sapiens GN=ISCA1 PE=1 SV=1 96 195 6.0E-32
sp|Q3SZG8|ISCA1_BOVIN Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Bos taurus GN=ISCA1 PE=2 SV=1 96 195 6.0E-32
sp|Q9D924|ISCA1_MOUSE Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Mus musculus GN=Isca1 PE=2 SV=1 96 195 8.0E-32
sp|Q80W96|ISCA1_RAT Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Rattus norvegicus GN=Isca1 PE=2 SV=1 96 195 8.0E-32
sp|P0DN75|ISCA1_COLLI Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Columba livia GN=ISCA1 PE=1 SV=1 96 195 2.0E-31
sp|Q8T3X9|ISCA1_DROME Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Drosophila melanogaster GN=l(1)G0136 PE=1 SV=1 79 195 5.0E-31
sp|Q4QRC6|ISCA1_DANRE Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Danio rerio GN=isca1 PE=2 SV=1 93 195 2.0E-27
sp|Q8LBM4|ISAM1_ARATH Iron-sulfur assembly protein IscA-like 1, mitochondrial OS=Arabidopsis thaliana GN=At2g16710 PE=2 SV=2 100 194 8.0E-26
sp|Q8L8C0|ISAM3_ARATH Iron-sulfur assembly protein IscA-like 3, mitochondrial OS=Arabidopsis thaliana GN=At2g36260 PE=3 SV=2 100 197 2.0E-24
sp|Q9ZD62|Y484_RICPR Uncharacterized protein RP484 OS=Rickettsia prowazekii (strain Madrid E) GN=RP484 PE=3 SV=1 101 194 3.0E-22
sp|Q54VS1|ISCA1_DICDI Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Dictyostelium discoideum GN=isca1 PE=3 SV=1 100 194 1.0E-19
sp|Q8GLE6|ISCA_XENNA Iron-binding protein IscA OS=Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / LMG 1036 / NCIB 9965 / AN6) GN=iscA PE=3 SV=1 103 202 1.0E-17
sp|B4EZU6|ISCA_PROMH Iron-binding protein IscA OS=Proteus mirabilis (strain HI4320) GN=iscA PE=3 SV=1 103 202 2.0E-17
sp|P44672|ISCA_HAEIN Iron-binding protein IscA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=iscA PE=3 SV=1 103 202 2.0E-17
sp|A8GHY1|ISCA_SERP5 Iron-binding protein IscA OS=Serratia proteamaculans (strain 568) GN=iscA PE=3 SV=1 103 202 4.0E-17
sp|B1JRZ0|ISCA_YERPY Iron-binding protein IscA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=iscA PE=3 SV=1 103 202 5.0E-17
sp|Q667Y3|ISCA_YERPS Iron-binding protein IscA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=iscA PE=3 SV=1 103 202 5.0E-17
sp|A4TMV2|ISCA_YERPP Iron-binding protein IscA OS=Yersinia pestis (strain Pestoides F) GN=iscA PE=3 SV=1 103 202 5.0E-17
sp|Q1CKA7|ISCA_YERPN Iron-binding protein IscA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=iscA PE=3 SV=1 103 202 5.0E-17
sp|A9R816|ISCA_YERPG Iron-binding protein IscA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=iscA PE=3 SV=1 103 202 5.0E-17
sp|Q8ZCS3|ISCA_YERPE Iron-binding protein IscA OS=Yersinia pestis GN=iscA PE=3 SV=1 103 202 5.0E-17
sp|B2K9R5|ISCA_YERPB Iron-binding protein IscA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=iscA PE=3 SV=1 103 202 5.0E-17
sp|Q1C5H2|ISCA_YERPA Iron-binding protein IscA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=iscA PE=3 SV=1 103 202 5.0E-17
sp|A7FFX3|ISCA_YERP3 Iron-binding protein IscA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=iscA PE=3 SV=1 103 202 5.0E-17
sp|A1JKQ4|ISCA_YERE8 Iron-binding protein IscA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=iscA PE=3 SV=1 103 202 6.0E-17
sp|Q6D261|ISCA_PECAS Iron-binding protein IscA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=iscA PE=3 SV=1 103 202 6.0E-17
sp|A6TCE9|ISCA_KLEP7 Iron-binding protein IscA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=iscA PE=3 SV=1 103 202 7.0E-17
sp|B5XNJ9|ISCA_KLEP3 Iron-binding protein IscA OS=Klebsiella pneumoniae (strain 342) GN=iscA PE=3 SV=1 103 202 7.0E-17
sp|B4T0S0|ISCA_SALNS Iron-binding protein IscA OS=Salmonella newport (strain SL254) GN=iscA PE=3 SV=1 103 202 8.0E-17
sp|Q7CQ12|ISCA_SALTY Iron-binding protein IscA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=iscA PE=3 SV=1 103 202 1.0E-16
sp|Q8XFZ8|ISCA_SALTI Iron-binding protein IscA OS=Salmonella typhi GN=iscA PE=3 SV=1 103 202 1.0E-16
sp|B4TRX3|ISCA_SALSV Iron-binding protein IscA OS=Salmonella schwarzengrund (strain CVM19633) GN=iscA PE=3 SV=1 103 202 1.0E-16
sp|B5BAW8|ISCA_SALPK Iron-binding protein IscA OS=Salmonella paratyphi A (strain AKU_12601) GN=iscA PE=3 SV=1 103 202 1.0E-16
sp|C0PYK9|ISCA_SALPC Iron-binding protein IscA OS=Salmonella paratyphi C (strain RKS4594) GN=iscA PE=3 SV=1 103 202 1.0E-16
sp|A9N1X7|ISCA_SALPB Iron-binding protein IscA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=iscA PE=3 SV=1 103 202 1.0E-16
sp|Q5PNG5|ISCA_SALPA Iron-binding protein IscA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=iscA PE=3 SV=1 103 202 1.0E-16
sp|B4TDB4|ISCA_SALHS Iron-binding protein IscA OS=Salmonella heidelberg (strain SL476) GN=iscA PE=3 SV=1 103 202 1.0E-16
sp|B5RD10|ISCA_SALG2 Iron-binding protein IscA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=iscA PE=3 SV=1 103 202 1.0E-16
sp|B5R5A0|ISCA_SALEP Iron-binding protein IscA OS=Salmonella enteritidis PT4 (strain P125109) GN=iscA PE=3 SV=1 103 202 1.0E-16
sp|B5FR83|ISCA_SALDC Iron-binding protein IscA OS=Salmonella dublin (strain CT_02021853) GN=iscA PE=3 SV=1 103 202 1.0E-16
sp|Q57LH1|ISCA_SALCH Iron-binding protein IscA OS=Salmonella choleraesuis (strain SC-B67) GN=iscA PE=3 SV=1 103 202 1.0E-16
sp|A9MHJ6|ISCA_SALAR Iron-binding protein IscA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=iscA PE=3 SV=1 103 202 1.0E-16
sp|B5F1B8|ISCA_SALA4 Iron-binding protein IscA OS=Salmonella agona (strain SL483) GN=iscA PE=3 SV=1 103 202 1.0E-16
sp|Q7N226|ISCA_PHOLL Iron-binding protein IscA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=iscA PE=3 SV=1 103 202 3.0E-16
sp|A4WDA9|ISCA_ENT38 Iron-binding protein IscA OS=Enterobacter sp. (strain 638) GN=iscA PE=3 SV=1 103 202 3.0E-16
sp|C6DBI9|ISCA_PECCP Iron-binding protein IscA OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=iscA PE=3 SV=1 103 202 1.0E-15
sp|C5BEU3|ISCA_EDWI9 Iron-binding protein IscA OS=Edwardsiella ictaluri (strain 93-146) GN=iscA PE=3 SV=1 103 202 2.0E-15
sp|Q3YZ24|ISCA_SHISS Iron-binding protein IscA OS=Shigella sonnei (strain Ss046) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|P0AAD1|ISCA_SHIFL Iron-binding protein IscA OS=Shigella flexneri GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|Q32D36|ISCA_SHIDS Iron-binding protein IscA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|Q31XW2|ISCA_SHIBS Iron-binding protein IscA OS=Shigella boydii serotype 4 (strain Sb227) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|B7LKB1|ISCA_ESCF3 Iron-binding protein IscA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|B1LNI4|ISCA_ECOSM Iron-binding protein IscA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|B6I5A0|ISCA_ECOSE Iron-binding protein IscA OS=Escherichia coli (strain SE11) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|B7N6B5|ISCA_ECOLU Iron-binding protein IscA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|P0AAC8|ISCA_ECOLI Iron-binding protein IscA OS=Escherichia coli (strain K12) GN=iscA PE=1 SV=1 103 202 4.0E-15
sp|B1IWD3|ISCA_ECOLC Iron-binding protein IscA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|P0AAC9|ISCA_ECOL6 Iron-binding protein IscA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|Q0TEV7|ISCA_ECOL5 Iron-binding protein IscA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|A1AE65|ISCA_ECOK1 Iron-binding protein IscA OS=Escherichia coli O1:K1 / APEC GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|B1XB03|ISCA_ECODH Iron-binding protein IscA OS=Escherichia coli (strain K12 / DH10B) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|C4ZXA3|ISCA_ECOBW Iron-binding protein IscA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|B7M7N1|ISCA_ECO8A Iron-binding protein IscA OS=Escherichia coli O8 (strain IAI1) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|B7MYG2|ISCA_ECO81 Iron-binding protein IscA OS=Escherichia coli O81 (strain ED1a) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|B7NRH7|ISCA_ECO7I Iron-binding protein IscA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|P0AAD0|ISCA_ECO57 Iron-binding protein IscA OS=Escherichia coli O157:H7 GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|B7LDC0|ISCA_ECO55 Iron-binding protein IscA OS=Escherichia coli (strain 55989 / EAEC) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|B7MIL8|ISCA_ECO45 Iron-binding protein IscA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|B7UGX4|ISCA_ECO27 Iron-binding protein IscA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=iscA PE=3 SV=1 103 202 4.0E-15
sp|A7MGY0|ISCA_CROS8 Iron-binding protein IscA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=iscA PE=3 SV=1 103 202 6.0E-15
sp|Q8Y242|ERPA_RALSO Putative iron-sulfur cluster insertion protein ErpA OS=Ralstonia solanacearum (strain GMI1000) GN=erpA PE=3 SV=1 102 203 1.0E-13
sp|B2UFK5|ERPA_RALPJ Putative iron-sulfur cluster insertion protein ErpA OS=Ralstonia pickettii (strain 12J) GN=erpA PE=3 SV=1 102 203 3.0E-13
sp|A4T031|ERPA_POLSQ Putative iron-sulfur cluster insertion protein ErpA OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=erpA PE=3 SV=1 109 203 2.0E-12
sp|Q39JJ8|ERPA_BURL3 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=erpA PE=3 SV=1 106 203 4.0E-12
sp|A4XZB1|ERPA_PSEMY Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas mendocina (strain ymp) GN=erpA PE=3 SV=1 102 203 4.0E-12
sp|P77667|SUFA_ECOLI Protein SufA OS=Escherichia coli (strain K12) GN=sufA PE=1 SV=1 97 202 4.0E-12
sp|B2AH60|ERPA_CUPTR Putative iron-sulfur cluster insertion protein ErpA OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=erpA PE=3 SV=1 106 203 4.0E-12
sp|Q475T0|ERPA_CUPPJ Putative iron-sulfur cluster insertion protein ErpA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=erpA PE=3 SV=1 106 203 4.0E-12
sp|Q0KED6|ERPA_CUPNH Putative iron-sulfur cluster insertion protein ErpA OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=erpA PE=3 SV=1 106 203 4.0E-12
sp|B0TIR0|ERPA_SHEHH Iron-sulfur cluster insertion protein ErpA OS=Shewanella halifaxensis (strain HAW-EB4) GN=erpA PE=3 SV=1 104 202 5.0E-12
sp|A4JBK6|ERPA1_BURVG Putative iron-sulfur cluster insertion protein ErpA 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=erpA1 PE=3 SV=1 106 203 5.0E-12
sp|Q1LRC6|ERPA_CUPMC Putative iron-sulfur cluster insertion protein ErpA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=erpA PE=3 SV=1 106 203 6.0E-12
sp|A8H175|ERPA_SHEPA Iron-sulfur cluster insertion protein ErpA OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=erpA PE=3 SV=1 104 194 7.0E-12
sp|Q3SF18|ERPA_THIDA Putative iron-sulfur cluster insertion protein ErpA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=erpA PE=3 SV=1 104 203 7.0E-12
sp|Q60C62|ERPA1_METCA Iron-sulfur cluster insertion protein ErpA 1 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=erpA1 PE=3 SV=1 97 194 8.0E-12
sp|A9AH79|ERPA_BURM1 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=erpA PE=3 SV=1 106 203 9.0E-12
sp|A8G9U9|ERPA_SERP5 Iron-sulfur cluster insertion protein ErpA OS=Serratia proteamaculans (strain 568) GN=erpA PE=3 SV=1 104 194 9.0E-12
sp|Q0BI89|ERPA_BURCM Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=erpA PE=3 SV=1 106 203 1.0E-11
sp|B1YTD3|ERPA_BURA4 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia ambifaria (strain MC40-6) GN=erpA PE=3 SV=1 106 203 1.0E-11
sp|Q9I5Q6|ERPA_PSEAE Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=erpA PE=3 SV=1 104 194 1.0E-11
sp|Q02TA1|ERPA_PSEAB Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=erpA PE=3 SV=1 104 194 1.0E-11
sp|B7V623|ERPA_PSEA8 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas aeruginosa (strain LESB58) GN=erpA PE=3 SV=1 104 194 1.0E-11
sp|A6UZG6|ERPA_PSEA7 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas aeruginosa (strain PA7) GN=erpA PE=3 SV=1 104 194 1.0E-11
sp|Q31IS8|ERPA_THICR Iron-sulfur cluster insertion protein ErpA OS=Thiomicrospira crunogena (strain XCL-2) GN=erpA PE=3 SV=1 104 203 1.0E-11
sp|A1WL78|ERPA_VEREI Putative iron-sulfur cluster insertion protein ErpA OS=Verminephrobacter eiseniae (strain EF01-2) GN=erpA PE=3 SV=1 109 203 1.0E-11
sp|Q1QSB5|ERPA_CHRSD Iron-sulfur cluster insertion protein ErpA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=erpA PE=3 SV=1 104 202 1.0E-11
sp|Q1GXC7|ERPA_METFK Putative iron-sulfur cluster insertion protein ErpA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=erpA PE=3 SV=1 104 203 1.0E-11
sp|A6VN49|ERPA_ACTSZ Iron-sulfur cluster insertion protein ErpA OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=erpA PE=3 SV=1 104 203 1.0E-11
sp|P74596|Y1565_SYNY3 Uncharacterized protein slr1565 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1565 PE=1 SV=1 104 197 2.0E-11
sp|Q9XIK3|ISCAP_ARATH Iron-sulfur assembly protein IscA, chloroplastic OS=Arabidopsis thaliana GN=ISCA PE=2 SV=2 101 202 2.0E-11
sp|B1JK20|ERPA_YERPY Iron-sulfur cluster insertion protein ErpA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=erpA PE=3 SV=1 104 194 2.0E-11
sp|Q66EE9|ERPA_YERPS Iron-sulfur cluster insertion protein ErpA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=erpA PE=3 SV=1 104 194 2.0E-11
sp|A4TPW8|ERPA_YERPP Iron-sulfur cluster insertion protein ErpA OS=Yersinia pestis (strain Pestoides F) GN=erpA PE=3 SV=1 104 194 2.0E-11
sp|Q1CLU5|ERPA_YERPN Iron-sulfur cluster insertion protein ErpA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=erpA PE=3 SV=1 104 194 2.0E-11
sp|A9R1E3|ERPA_YERPG Iron-sulfur cluster insertion protein ErpA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=erpA PE=3 SV=1 104 194 2.0E-11
sp|Q0WBQ9|ERPA_YERPE Iron-sulfur cluster insertion protein ErpA OS=Yersinia pestis GN=erpA PE=3 SV=1 104 194 2.0E-11
sp|B2K550|ERPA_YERPB Iron-sulfur cluster insertion protein ErpA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=erpA PE=3 SV=1 104 194 2.0E-11
sp|Q1C3X3|ERPA_YERPA Iron-sulfur cluster insertion protein ErpA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=erpA PE=3 SV=1 104 194 2.0E-11
sp|A7FM07|ERPA_YERP3 Iron-sulfur cluster insertion protein ErpA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=erpA PE=3 SV=1 104 194 2.0E-11
sp|Q2NVP9|ERPA_SODGM Iron-sulfur cluster insertion protein ErpA OS=Sodalis glossinidius (strain morsitans) GN=erpA PE=3 SV=1 104 194 2.0E-11
sp|C5BAP7|ERPA_EDWI9 Iron-sulfur cluster insertion protein ErpA OS=Edwardsiella ictaluri (strain 93-146) GN=erpA PE=3 SV=1 104 194 2.0E-11
sp|A4SJ82|ERPA_AERS4 Iron-sulfur cluster insertion protein ErpA OS=Aeromonas salmonicida (strain A449) GN=erpA PE=3 SV=1 104 203 2.0E-11
sp|A0KNY6|ERPA_AERHH Iron-sulfur cluster insertion protein ErpA OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=erpA PE=3 SV=2 104 203 2.0E-11
sp|A2SKL7|ERPA_METPP Putative iron-sulfur cluster insertion protein ErpA OS=Methylibium petroleiphilum (strain PM1) GN=erpA PE=3 SV=1 102 203 2.0E-11
sp|B4EET4|ERPA_BURCJ Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=erpA PE=3 SV=1 106 203 2.0E-11
sp|A0K4K7|ERPA_BURCH Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia cenocepacia (strain HI2424) GN=erpA PE=3 SV=1 106 203 2.0E-11
sp|B1JVU6|ERPA_BURCC Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia cenocepacia (strain MC0-3) GN=erpA PE=3 SV=1 106 203 2.0E-11
sp|Q1BZ43|ERPA_BURCA Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia cenocepacia (strain AU 1054) GN=erpA PE=3 SV=1 106 203 2.0E-11
sp|A1JJQ3|ERPA_YERE8 Iron-sulfur cluster insertion protein ErpA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=erpA PE=3 SV=1 104 194 2.0E-11
sp|A7MGR3|ERPA_CROS8 Iron-sulfur cluster insertion protein ErpA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=erpA PE=3 SV=1 104 203 2.0E-11
sp|A3QBP0|ERPA_SHELP Iron-sulfur cluster insertion protein ErpA OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=erpA PE=3 SV=1 104 202 2.0E-11
sp|B8CQR0|ERPA_SHEPW Iron-sulfur cluster insertion protein ErpA OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=erpA PE=3 SV=1 104 202 3.0E-11
sp|A4W6Q3|ERPA_ENT38 Iron-sulfur cluster insertion protein ErpA OS=Enterobacter sp. (strain 638) GN=erpA PE=3 SV=1 104 194 3.0E-11
sp|Q0ABJ8|ERPA_ALKEH Iron-sulfur cluster insertion protein ErpA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=erpA PE=3 SV=1 89 203 3.0E-11
sp|Q2SZ67|ERPA_BURTA Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=erpA PE=3 SV=1 106 203 3.0E-11
sp|Q63QW5|ERPA_BURPS Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia pseudomallei (strain K96243) GN=erpA PE=3 SV=1 106 203 3.0E-11
sp|A3NDG6|ERPA_BURP6 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia pseudomallei (strain 668) GN=erpA PE=3 SV=1 106 203 3.0E-11
sp|Q3JNR3|ERPA_BURP1 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia pseudomallei (strain 1710b) GN=erpA PE=3 SV=1 106 203 3.0E-11
sp|A3NZ78|ERPA_BURP0 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia pseudomallei (strain 1106a) GN=erpA PE=3 SV=1 106 203 3.0E-11
sp|A1V053|ERPA_BURMS Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia mallei (strain SAVP1) GN=erpA PE=3 SV=1 106 203 3.0E-11
sp|Q62HB8|ERPA_BURMA Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia mallei (strain ATCC 23344) GN=erpA PE=3 SV=1 106 203 3.0E-11
sp|A2S583|ERPA_BURM9 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia mallei (strain NCTC 10229) GN=erpA PE=3 SV=1 106 203 3.0E-11
sp|A3MP61|ERPA_BURM7 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia mallei (strain NCTC 10247) GN=erpA PE=3 SV=1 106 203 3.0E-11
sp|A1W3Q0|ERPA_ACISJ Putative iron-sulfur cluster insertion protein ErpA OS=Acidovorax sp. (strain JS42) GN=erpA PE=3 SV=1 109 203 3.0E-11
sp|Q12KD2|ERPA_SHEDO Iron-sulfur cluster insertion protein ErpA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=erpA PE=3 SV=1 104 202 4.0E-11
sp|Q4ZMM4|ERPA_PSEU2 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=erpA PE=3 SV=1 103 203 4.0E-11
sp|Q889Z2|ERPA_PSESM Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=erpA PE=3 SV=1 103 203 4.0E-11
sp|Q48NN6|ERPA_PSE14 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=erpA PE=3 SV=1 103 203 4.0E-11
sp|B2VE26|ERPA_ERWT9 Iron-sulfur cluster insertion protein ErpA OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=erpA PE=3 SV=1 104 194 5.0E-11
sp|A9C177|ERPA_DELAS Putative iron-sulfur cluster insertion protein ErpA OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=erpA PE=3 SV=1 108 203 5.0E-11
sp|A1TUF2|ERPA_ACIAC Putative iron-sulfur cluster insertion protein ErpA OS=Acidovorax citrulli (strain AAC00-1) GN=erpA PE=3 SV=1 109 203 6.0E-11
sp|A1TYH3|ERPA_MARHV Iron-sulfur cluster insertion protein ErpA OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=erpA PE=3 SV=1 104 203 7.0E-11
sp|A8ALD2|ERPA_CITK8 Iron-sulfur cluster insertion protein ErpA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=erpA PE=3 SV=1 104 194 7.0E-11
sp|A4G1T7|ERPA_HERAR Putative iron-sulfur cluster insertion protein ErpA OS=Herminiimonas arsenicoxydans GN=erpA PE=3 SV=1 109 203 8.0E-11
sp|Q220S8|ERPA_RHOFT Putative iron-sulfur cluster insertion protein ErpA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=erpA PE=3 SV=1 109 203 8.0E-11
sp|B2JGV0|ERPA_BURP8 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=erpA PE=3 SV=1 106 203 9.0E-11
sp|O32113|SUFA_BACSU Uncharacterized protein SufA OS=Bacillus subtilis (strain 168) GN=sufA PE=3 SV=1 106 194 9.0E-11
sp|Q0HSF0|ERPA_SHESR Iron-sulfur cluster insertion protein ErpA OS=Shewanella sp. (strain MR-7) GN=erpA PE=3 SV=1 104 202 9.0E-11
sp|Q0HG57|ERPA_SHESM Iron-sulfur cluster insertion protein ErpA OS=Shewanella sp. (strain MR-4) GN=erpA PE=3 SV=1 104 202 9.0E-11
sp|A0KZS2|ERPA_SHESA Iron-sulfur cluster insertion protein ErpA OS=Shewanella sp. (strain ANA-3) GN=erpA PE=3 SV=1 104 202 9.0E-11
sp|Q7CR66|ERPA_SALTY Iron-sulfur cluster insertion protein ErpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=erpA PE=3 SV=2 104 194 9.0E-11
sp|Q8XFF3|ERPA_SALTI Iron-sulfur cluster insertion protein ErpA OS=Salmonella typhi GN=erpA PE=3 SV=2 104 194 9.0E-11
sp|B4TXQ8|ERPA_SALSV Iron-sulfur cluster insertion protein ErpA OS=Salmonella schwarzengrund (strain CVM19633) GN=erpA PE=3 SV=1 104 194 9.0E-11
sp|A9N0Q2|ERPA_SALPB Iron-sulfur cluster insertion protein ErpA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=erpA PE=3 SV=1 104 194 9.0E-11
sp|Q5PD49|ERPA_SALPA Iron-sulfur cluster insertion protein ErpA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=erpA PE=3 SV=2 104 194 9.0E-11
sp|B4SUY6|ERPA_SALNS Iron-sulfur cluster insertion protein ErpA OS=Salmonella newport (strain SL254) GN=erpA PE=3 SV=1 104 194 9.0E-11
sp|B4TK32|ERPA_SALHS Iron-sulfur cluster insertion protein ErpA OS=Salmonella heidelberg (strain SL476) GN=erpA PE=3 SV=1 104 194 9.0E-11
sp|B5RHE2|ERPA_SALG2 Iron-sulfur cluster insertion protein ErpA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=erpA PE=3 SV=1 104 194 9.0E-11
sp|B5R3G8|ERPA_SALEP Iron-sulfur cluster insertion protein ErpA OS=Salmonella enteritidis PT4 (strain P125109) GN=erpA PE=3 SV=1 104 194 9.0E-11
sp|B5FJ03|ERPA_SALDC Iron-sulfur cluster insertion protein ErpA OS=Salmonella dublin (strain CT_02021853) GN=erpA PE=3 SV=1 104 194 9.0E-11
sp|Q57T51|ERPA_SALCH Iron-sulfur cluster insertion protein ErpA OS=Salmonella choleraesuis (strain SC-B67) GN=erpA PE=3 SV=2 104 194 9.0E-11
sp|A9MPK5|ERPA_SALAR Iron-sulfur cluster insertion protein ErpA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=erpA PE=3 SV=1 104 194 9.0E-11
sp|B5F8R7|ERPA_SALA4 Iron-sulfur cluster insertion protein ErpA OS=Salmonella agona (strain SL483) GN=erpA PE=3 SV=1 104 194 9.0E-11
sp|Q8EHC4|ERPA_SHEON Iron-sulfur cluster insertion protein ErpA OS=Shewanella oneidensis (strain MR-1) GN=erpA PE=3 SV=2 104 202 1.0E-10
sp|Q6D1Z1|ERPA_PECAS Iron-sulfur cluster insertion protein ErpA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|Q9CNH3|ERPA_PASMU Iron-sulfur cluster insertion protein ErpA OS=Pasteurella multocida (strain Pm70) GN=erpA PE=3 SV=1 104 203 1.0E-10
sp|A1RMG3|ERPA_SHESW Iron-sulfur cluster insertion protein ErpA OS=Shewanella sp. (strain W3-18-1) GN=erpA PE=3 SV=1 104 202 1.0E-10
sp|A4Y4G8|ERPA_SHEPC Iron-sulfur cluster insertion protein ErpA OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=erpA PE=3 SV=1 104 202 1.0E-10
sp|Q7N843|ERPA_PHOLL Iron-sulfur cluster insertion protein ErpA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|Q124P0|ERPA_POLSJ Putative iron-sulfur cluster insertion protein ErpA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=erpA PE=3 SV=1 109 203 1.0E-10
sp|Q1LTN5|ERPA_BAUCH Iron-sulfur cluster insertion protein ErpA OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=erpA PE=3 SV=1 104 203 1.0E-10
sp|A6T4W0|ERPA_KLEP7 Iron-sulfur cluster insertion protein ErpA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|Q3Z5K1|ERPA_SHISS Iron-sulfur cluster insertion protein ErpA OS=Shigella sonnei (strain Ss046) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|P0ACC6|ERPA_SHIFL Iron-sulfur cluster insertion protein ErpA OS=Shigella flexneri GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|Q0T850|ERPA_SHIF8 Iron-sulfur cluster insertion protein ErpA OS=Shigella flexneri serotype 5b (strain 8401) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|Q32JV2|ERPA_SHIDS Iron-sulfur cluster insertion protein ErpA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|Q325Y3|ERPA_SHIBS Iron-sulfur cluster insertion protein ErpA OS=Shigella boydii serotype 4 (strain Sb227) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|B2U301|ERPA_SHIB3 Iron-sulfur cluster insertion protein ErpA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|B7LWB7|ERPA_ESCF3 Iron-sulfur cluster insertion protein ErpA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|Q1RG32|ERPA_ECOUT Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain UTI89 / UPEC) GN=erpA PE=3 SV=2 104 194 1.0E-10
sp|B1LGV9|ERPA_ECOSM Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|B6HZD2|ERPA_ECOSE Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain SE11) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|B7N825|ERPA_ECOLU Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|P0ACC3|ERPA_ECOLI Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain K12) GN=erpA PE=1 SV=1 104 194 1.0E-10
sp|B1IQI4|ERPA_ECOLC Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|P0ACC4|ERPA_ECOL6 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|Q0TLH5|ERPA_ECOL5 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|A1A7K2|ERPA_ECOK1 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O1:K1 / APEC GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|A7ZWA4|ERPA_ECOHS Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O9:H4 (strain HS) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|B1XD26|ERPA_ECODH Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain K12 / DH10B) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|C4ZRP9|ERPA_ECOBW Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|B7M197|ERPA_ECO8A Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O8 (strain IAI1) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|B7MP18|ERPA_ECO81 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O81 (strain ED1a) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|B7NIB9|ERPA_ECO7I Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|B5Z0D6|ERPA_ECO5E Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|P0ACC5|ERPA_ECO57 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O157:H7 GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|B7LGL8|ERPA_ECO55 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain 55989 / EAEC) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|B7MBD9|ERPA_ECO45 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|B7UIK3|ERPA_ECO27 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|A7ZHP8|ERPA_ECO24 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=erpA PE=3 SV=1 104 194 1.0E-10
sp|Q07YU9|ERPA_SHEFN Iron-sulfur cluster insertion protein ErpA OS=Shewanella frigidimarina (strain NCIMB 400) GN=erpA PE=3 SV=1 104 194 2.0E-10
sp|Q15YG5|ERPA_PSEA6 Iron-sulfur cluster insertion protein ErpA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=erpA PE=3 SV=1 104 202 2.0E-10
sp|Q65SZ6|ERPA_MANSM Iron-sulfur cluster insertion protein ErpA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=erpA PE=3 SV=1 104 203 2.0E-10
sp|Q4K514|ERPA_PSEF5 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=erpA PE=3 SV=1 103 203 2.0E-10
sp|B5Y1L3|ERPA_KLEP3 Iron-sulfur cluster insertion protein ErpA OS=Klebsiella pneumoniae (strain 342) GN=erpA PE=3 SV=1 104 194 2.0E-10
sp|B4EUE2|ERPA_PROMH Iron-sulfur cluster insertion protein ErpA OS=Proteus mirabilis (strain HI4320) GN=erpA PE=3 SV=1 104 194 2.0E-10
sp|A6SUP2|ERPA_JANMA Putative iron-sulfur cluster insertion protein ErpA OS=Janthinobacterium sp. (strain Marseille) GN=erpA PE=3 SV=1 109 203 2.0E-10
sp|Q21MI1|ERPA_SACD2 Iron-sulfur cluster insertion protein ErpA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=erpA PE=3 SV=1 104 203 2.0E-10
sp|Q5P7U0|ERPA_AROAE Putative iron-sulfur cluster insertion protein ErpA OS=Aromatoleum aromaticum (strain EbN1) GN=erpA PE=3 SV=1 104 203 2.0E-10
sp|B0U4D9|ERPA_XYLFM Iron-sulfur cluster insertion protein ErpA OS=Xylella fastidiosa (strain M12) GN=erpA PE=3 SV=1 104 194 3.0E-10
sp|A1K969|ERPA_AZOSB Putative iron-sulfur cluster insertion protein ErpA OS=Azoarcus sp. (strain BH72) GN=erpA PE=3 SV=1 104 203 3.0E-10
sp|B8F870|ERPA_HAEPS Iron-sulfur cluster insertion protein ErpA OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=erpA PE=3 SV=1 104 202 3.0E-10
sp|A9L5J9|ERPA_SHEB9 Iron-sulfur cluster insertion protein ErpA OS=Shewanella baltica (strain OS195) GN=erpA PE=3 SV=1 104 202 3.0E-10
sp|A6WKM0|ERPA_SHEB8 Iron-sulfur cluster insertion protein ErpA OS=Shewanella baltica (strain OS185) GN=erpA PE=3 SV=1 104 202 3.0E-10
sp|A3D1R9|ERPA_SHEB5 Iron-sulfur cluster insertion protein ErpA OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=erpA PE=3 SV=1 104 202 3.0E-10
sp|B8EBT9|ERPA_SHEB2 Iron-sulfur cluster insertion protein ErpA OS=Shewanella baltica (strain OS223) GN=erpA PE=3 SV=1 104 202 3.0E-10
sp|Q8PD57|ERPA_XANCP Iron-sulfur cluster insertion protein ErpA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=erpA PE=3 SV=1 104 203 4.0E-10
sp|B0RN15|ERPA_XANCB Iron-sulfur cluster insertion protein ErpA OS=Xanthomonas campestris pv. campestris (strain B100) GN=erpA PE=3 SV=1 104 203 4.0E-10
sp|Q4UZE2|ERPA_XANC8 Iron-sulfur cluster insertion protein ErpA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=erpA PE=3 SV=1 104 203 4.0E-10
sp|B2FJT4|ERPA_STRMK Iron-sulfur cluster insertion protein ErpA OS=Stenotrophomonas maltophilia (strain K279a) GN=erpA PE=3 SV=1 104 203 4.0E-10
sp|Q3BY98|ERPA_XANC5 Iron-sulfur cluster insertion protein ErpA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=erpA PE=3 SV=1 90 194 4.0E-10
sp|P72731|Y1417_SYNY3 Uncharacterized protein slr1417 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1417 PE=3 SV=1 103 202 4.0E-10
sp|P64343|ERPA_XYLFT Iron-sulfur cluster insertion protein ErpA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=erpA PE=3 SV=1 104 194 4.0E-10
sp|P64342|ERPA_XYLFA Iron-sulfur cluster insertion protein ErpA OS=Xylella fastidiosa (strain 9a5c) GN=erpA PE=3 SV=1 104 194 4.0E-10
sp|B2I891|ERPA_XYLF2 Iron-sulfur cluster insertion protein ErpA OS=Xylella fastidiosa (strain M23) GN=erpA PE=3 SV=1 104 194 4.0E-10
sp|Q1IFY7|ERPA_PSEE4 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas entomophila (strain L48) GN=erpA PE=3 SV=1 103 203 4.0E-10
sp|Q7MHZ0|ERPA_VIBVY Iron-sulfur cluster insertion protein ErpA OS=Vibrio vulnificus (strain YJ016) GN=erpA PE=3 SV=2 104 202 4.0E-10
sp|Q9X4A0|ERPA_HAEDU Iron-sulfur cluster insertion protein ErpA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=erpA PE=3 SV=1 104 203 4.0E-10
sp|Q60AU6|ERPA2_METCA Iron-sulfur cluster insertion protein ErpA 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=erpA2 PE=3 SV=1 104 203 4.0E-10
sp|Q8DBX7|ERPA_VIBVU Iron-sulfur cluster insertion protein ErpA OS=Vibrio vulnificus (strain CMCP6) GN=erpA PE=3 SV=3 104 202 5.0E-10
sp|A9I246|ERPA_BORPD Putative iron-sulfur cluster insertion protein ErpA OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=erpA PE=3 SV=1 104 203 5.0E-10
sp|Q3K5W6|ERPA_PSEPF Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas fluorescens (strain Pf0-1) GN=erpA PE=3 SV=1 103 203 5.0E-10
sp|A4JRL3|ERPA2_BURVG Putative iron-sulfur cluster insertion protein ErpA 2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=erpA2 PE=3 SV=1 99 203 6.0E-10
sp|Q47VA3|ERPA_COLP3 Iron-sulfur cluster insertion protein ErpA OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=erpA PE=3 SV=1 109 203 7.0E-10
sp|C3K2Z6|ERPA_PSEFS Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas fluorescens (strain SBW25) GN=erpA PE=3 SV=1 103 203 7.0E-10
sp|Q8PQ32|ERPA_XANAC Iron-sulfur cluster insertion protein ErpA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=erpA PE=3 SV=1 104 203 7.0E-10
sp|A1VJJ5|ERPA1_POLNA Putative iron-sulfur cluster insertion protein ErpA 1 OS=Polaromonas naphthalenivorans (strain CJ2) GN=erpA1 PE=3 SV=1 109 194 8.0E-10
sp|A4VHK9|ERPA_PSEU5 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas stutzeri (strain A1501) GN=erpA PE=3 SV=1 103 194 9.0E-10
sp|Q47IC1|ERPA_DECAR Putative iron-sulfur cluster insertion protein ErpA OS=Dechloromonas aromatica (strain RCB) GN=erpA PE=3 SV=1 115 203 9.0E-10
sp|B4SLD1|ERPA_STRM5 Iron-sulfur cluster insertion protein ErpA OS=Stenotrophomonas maltophilia (strain R551-3) GN=erpA PE=3 SV=1 104 194 1.0E-09
sp|B5FAL7|ERPA_VIBFM Iron-sulfur cluster insertion protein ErpA OS=Vibrio fischeri (strain MJ11) GN=erpA PE=3 SV=1 104 202 1.0E-09
sp|Q5E2W7|ERPA_VIBF1 Iron-sulfur cluster insertion protein ErpA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=erpA PE=3 SV=1 104 202 1.0E-09
sp|Q5H5J1|ERPA_XANOR Iron-sulfur cluster insertion protein ErpA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=erpA PE=3 SV=2 104 194 1.0E-09
sp|Q2P884|ERPA_XANOM Iron-sulfur cluster insertion protein ErpA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=erpA PE=3 SV=1 104 194 1.0E-09
sp|B2SYK8|ERPA_BURPP Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=erpA PE=3 SV=1 106 203 1.0E-09
sp|Q13UB4|ERPA1_BURXL Putative iron-sulfur cluster insertion protein ErpA 1 OS=Burkholderia xenovorans (strain LB400) GN=erpA1 PE=3 SV=1 106 203 1.0E-09
sp|B5EQH0|ERPA_ACIF5 Iron-sulfur cluster insertion protein ErpA OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=erpA PE=3 SV=1 104 203 1.0E-09
sp|B7JAH6|ERPA_ACIF2 Iron-sulfur cluster insertion protein ErpA OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=erpA PE=3 SV=1 104 203 1.0E-09
sp|B4RWS2|ERPA_ALTMD Iron-sulfur cluster insertion protein ErpA OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=erpA PE=3 SV=2 104 202 1.0E-09
sp|B0UU19|ERPA_HISS2 Iron-sulfur cluster insertion protein ErpA OS=Histophilus somni (strain 2336) GN=erpA PE=3 SV=1 104 203 1.0E-09
sp|Q0I3N9|ERPA_HAES1 Iron-sulfur cluster insertion protein ErpA OS=Haemophilus somnus (strain 129Pt) GN=erpA PE=3 SV=1 104 203 1.0E-09
sp|Q82UQ4|ERPA_NITEU Putative iron-sulfur cluster insertion protein ErpA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=erpA PE=3 SV=1 104 203 2.0E-09
sp|A5UFF5|ERPA_HAEIG Iron-sulfur cluster insertion protein ErpA OS=Haemophilus influenzae (strain PittGG) GN=erpA PE=3 SV=1 104 203 2.0E-09
sp|Q4QJM4|ERPA_HAEI8 Iron-sulfur cluster insertion protein ErpA OS=Haemophilus influenzae (strain 86-028NP) GN=erpA PE=3 SV=1 104 203 2.0E-09
sp|Q2KV08|ERPA_BORA1 Putative iron-sulfur cluster insertion protein ErpA OS=Bordetella avium (strain 197N) GN=erpA PE=3 SV=1 104 203 2.0E-09
sp|C1DHX9|ERPA_AZOVD Iron-sulfur cluster insertion protein ErpA OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=erpA PE=3 SV=1 104 194 2.0E-09
sp|P45344|ERPA_HAEIN Iron-sulfur cluster insertion protein ErpA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=erpA PE=1 SV=1 104 203 2.0E-09
sp|A5UBF7|ERPA_HAEIE Iron-sulfur cluster insertion protein ErpA OS=Haemophilus influenzae (strain PittEE) GN=erpA PE=3 SV=1 104 203 2.0E-09
sp|Q87LY4|ERPA_VIBPA Iron-sulfur cluster insertion protein ErpA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=erpA PE=3 SV=1 104 202 2.0E-09
sp|Q7VUW2|ERPA_BORPE Putative iron-sulfur cluster insertion protein ErpA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=erpA PE=3 SV=1 104 203 3.0E-09
sp|Q7W3Z5|ERPA_BORPA Putative iron-sulfur cluster insertion protein ErpA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=erpA PE=3 SV=1 104 203 3.0E-09
sp|Q7WFC7|ERPA_BORBR Putative iron-sulfur cluster insertion protein ErpA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=erpA PE=3 SV=1 104 203 3.0E-09
sp|Q9MSA1|YCF83_GALSU Uncharacterized protein ycf83 OS=Galdieria sulphuraria GN=ycf83 PE=3 SV=1 104 194 3.0E-09
sp|A3N2B0|ERPA_ACTP2 Iron-sulfur cluster insertion protein ErpA OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=erpA PE=3 SV=1 104 203 3.0E-09
sp|Q7NRT6|ERPA_CHRVO Putative iron-sulfur cluster insertion protein ErpA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=erpA PE=3 SV=1 104 203 3.0E-09
sp|Q1QES5|ERPA_PSYCK Iron-sulfur cluster insertion protein ErpA OS=Psychrobacter cryohalolentis (strain K5) GN=erpA PE=3 SV=1 92 203 5.0E-09
sp|Q4FVP8|ERPA_PSYA2 Iron-sulfur cluster insertion protein ErpA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=erpA PE=3 SV=1 92 203 5.0E-09
sp|B3H296|ERPA_ACTP7 Iron-sulfur cluster insertion protein ErpA OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=erpA PE=3 SV=1 106 203 5.0E-09
sp|Q2S8Y5|ERPA_HAHCH Iron-sulfur cluster insertion protein ErpA OS=Hahella chejuensis (strain KCTC 2396) GN=erpA PE=3 SV=1 109 203 5.0E-09
sp|Q6LUS1|ERPA_PHOPR Iron-sulfur cluster insertion protein ErpA OS=Photobacterium profundum GN=erpA PE=3 SV=1 104 202 5.0E-09
sp|Q13N17|ERPA2_BURXL Putative iron-sulfur cluster insertion protein ErpA 2 OS=Burkholderia xenovorans (strain LB400) GN=erpA2 PE=3 SV=1 71 203 5.0E-09
sp|Q88QQ5|ERPA_PSEPK Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas putida (strain KT2440) GN=erpA PE=3 SV=2 103 194 6.0E-09
sp|Q6FG12|ERPA_ACIAD Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=erpA PE=3 SV=1 103 203 6.0E-09
sp|P46053|HESB_LEPBY Protein HesB OS=Leptolyngbya boryana GN=hesB PE=3 SV=1 104 202 6.0E-09
sp|Q0AFU6|ERPA_NITEC Putative iron-sulfur cluster insertion protein ErpA OS=Nitrosomonas eutropha (strain C91) GN=erpA PE=3 SV=1 104 193 7.0E-09
sp|Q3IHQ0|ERPA_PSEHT Iron-sulfur cluster insertion protein ErpA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=erpA PE=3 SV=1 104 203 9.0E-09
sp|Q0VSN8|ERPA_ALCBS Iron-sulfur cluster insertion protein ErpA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=erpA PE=3 SV=2 100 203 9.0E-09
sp|A1AXV9|ERPA_RUTMC Iron-sulfur cluster insertion protein ErpA OS=Ruthia magnifica subsp. Calyptogena magnifica GN=erpA PE=3 SV=1 94 194 1.0E-08
sp|A1VMK3|ERPA2_POLNA Putative iron-sulfur cluster insertion protein ErpA 2 OS=Polaromonas naphthalenivorans (strain CJ2) GN=erpA2 PE=3 SV=1 107 203 1.0E-08
sp|A7MUU6|ERPA_VIBCB Iron-sulfur cluster insertion protein ErpA OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=erpA PE=3 SV=2 104 202 1.0E-08
sp|B0BR51|ERPA_ACTPJ Iron-sulfur cluster insertion protein ErpA OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=erpA PE=3 SV=1 106 203 2.0E-08
sp|A5CVH1|ERPA_VESOH Iron-sulfur cluster insertion protein ErpA OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=erpA PE=3 SV=1 99 194 2.0E-08
sp|Q5QVQ4|ERPA_IDILO Iron-sulfur cluster insertion protein ErpA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=erpA PE=3 SV=1 104 203 3.0E-08
sp|B7VJJ4|ERPA_VIBTL Iron-sulfur cluster insertion protein ErpA OS=Vibrio tasmaniensis (strain LGP32) GN=erpA PE=3 SV=1 104 194 4.0E-08
sp|Q44540|YNIU_AZOVI Uncharacterized protein in nifU 5'region OS=Azotobacter vinelandii PE=3 SV=1 126 202 4.0E-08
sp|B6EL03|ERPA_ALISL Iron-sulfur cluster insertion protein ErpA OS=Aliivibrio salmonicida (strain LFI1238) GN=erpA PE=3 SV=1 104 202 4.0E-08
sp|A1WVE3|ERPA_HALHL Iron-sulfur cluster insertion protein ErpA OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=erpA PE=3 SV=1 92 203 4.0E-08
sp|C3LSN2|ERPA_VIBCM Iron-sulfur cluster insertion protein ErpA OS=Vibrio cholerae serotype O1 (strain M66-2) GN=erpA PE=3 SV=1 104 194 5.0E-08
sp|Q9KU96|ERPA_VIBCH Iron-sulfur cluster insertion protein ErpA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=erpA PE=3 SV=1 104 194 5.0E-08
sp|A5F947|ERPA_VIBC3 Iron-sulfur cluster insertion protein ErpA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=erpA PE=3 SV=1 104 194 5.0E-08
sp|A1ST94|ERPA_PSYIN Iron-sulfur cluster insertion protein ErpA OS=Psychromonas ingrahamii (strain 37) GN=erpA PE=3 SV=1 104 203 6.0E-08
sp|Q3JC94|ERPA_NITOC Iron-sulfur cluster insertion protein ErpA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=erpA PE=3 SV=1 104 194 9.0E-08
sp|O67709|Y1857_AQUAE Protein aq_1857 OS=Aquifex aeolicus (strain VF5) GN=aq_1857 PE=1 SV=1 98 203 1.0E-07
sp|Q1XDR9|YCF83_PYRYE Uncharacterized protein ycf83 OS=Pyropia yezoensis GN=ycf83 PE=3 SV=1 104 202 2.0E-07
sp|P46052|HESB2_ANAVT Protein HesB, vegetative OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hesB2 PE=2 SV=1 104 202 2.0E-07
sp|A1S3U4|ERPA_SHEAM Iron-sulfur cluster insertion protein ErpA OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=erpA PE=3 SV=1 119 202 2.0E-07
sp|P37029|Y1755_BRADU Uncharacterized protein blr1755 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr1755 PE=3 SV=2 104 202 2.0E-07
sp|B0VAE9|ERPA_ACIBY Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain AYE) GN=erpA PE=3 SV=1 103 203 3.0E-07
sp|A3M0R4|ERPA_ACIBT Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=erpA PE=3 SV=2 103 203 3.0E-07
sp|B2I2I7|ERPA_ACIBC Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain ACICU) GN=erpA PE=3 SV=1 103 203 3.0E-07
sp|B7IAZ8|ERPA_ACIB5 Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain AB0057) GN=erpA PE=3 SV=1 103 203 3.0E-07
sp|B7GUY5|ERPA_ACIB3 Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain AB307-0294) GN=erpA PE=3 SV=1 103 203 3.0E-07
sp|Q8LCY2|ISAM2_ARATH Iron-sulfur assembly protein IscA-like 2, mitochondrial OS=Arabidopsis thaliana GN=At5g03905 PE=2 SV=2 103 189 3.0E-07
sp|B0VML0|ERPA_ACIBS Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain SDF) GN=erpA PE=3 SV=1 103 203 3.0E-07
sp|Q2YBK7|ERPA_NITMU Putative iron-sulfur cluster insertion protein ErpA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=erpA PE=3 SV=2 104 203 3.0E-07
sp|C4K3H0|ERPA_HAMD5 Iron-sulfur cluster insertion protein ErpA OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=erpA PE=3 SV=1 98 194 5.0E-07
sp|A4IZA5|ERPA_FRATW Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=erpA PE=3 SV=1 104 194 1.0E-06
sp|Q5NGX6|ERPA_FRATT Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=erpA PE=3 SV=1 104 194 1.0E-06
sp|Q0BKU2|ERPA_FRATO Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=erpA PE=3 SV=1 104 194 1.0E-06
sp|A0Q5J0|ERPA_FRATN Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. novicida (strain U112) GN=erpA PE=3 SV=1 104 194 1.0E-06
sp|B2SDK6|ERPA_FRATM Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=erpA PE=3 SV=1 104 194 1.0E-06
sp|Q2A270|ERPA_FRATH Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=erpA PE=3 SV=1 104 194 1.0E-06
sp|A7NDP2|ERPA_FRATF Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=erpA PE=3 SV=1 104 194 1.0E-06
sp|Q14IC8|ERPA_FRAT1 Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=erpA PE=3 SV=1 104 194 1.0E-06
sp|Q8KA13|Y114_BUCAP Uncharacterized protein BUsg_114 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=BUsg_114 PE=3 SV=1 97 195 1.0E-06
sp|A1KSG6|ERPA_NEIMF Putative iron-sulfur cluster insertion protein ErpA OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=erpA PE=3 SV=1 116 194 1.0E-06
sp|Q7DDN1|ERPA_NEIMB Putative iron-sulfur cluster insertion protein ErpA OS=Neisseria meningitidis serogroup B (strain MC58) GN=erpA PE=3 SV=1 116 194 1.0E-06
sp|A1IQG0|ERPA_NEIMA Putative iron-sulfur cluster insertion protein ErpA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=erpA PE=3 SV=1 116 194 1.0E-06
sp|Q5F6W8|ERPA_NEIG1 Putative iron-sulfur cluster insertion protein ErpA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=erpA PE=3 SV=1 116 194 1.0E-06
sp|Q53211|Y4VC_RHISN Uncharacterized protein y4vC OS=Rhizobium sp. (strain NGR234) GN=NGR_a01210 PE=3 SV=1 104 194 2.0E-06
sp|P18501|HESB_NOSS1 Protein HesB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hesB PE=3 SV=2 104 202 2.0E-06
sp|B0TZ08|ERPA_FRAP2 Iron-sulfur cluster insertion protein ErpA OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=erpA PE=3 SV=1 104 194 3.0E-06
sp|P46051|HESB1_ANAVT Protein HesB, heterocyst OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hesB1 PE=2 SV=1 104 202 5.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3149
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3236
Ophiocordyceps australis map64 (Brazil) OphauB2|6756
Ophiocordyceps camponoti-floridani Ophcf2|06714
Ophiocordyceps camponoti-rufipedis Ophun1|456 (this protein)
Ophiocordyceps kimflemingae Ophio5|3672
Ophiocordyceps subramaniannii Hirsu2|5542

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|456
MMASLAVARAALRHCRRHPTARLLPTVRVASYHSYPLPSNAAPNADVTETPIAQPEPLPSRRYDSHGSGAQQVAT
PSSATGGAVTPKQKSVRPRTKFRPRKAAMRLTPAAVERLRLLLDQPEPKLIKVGVRNRGCSGLAYHLEYVDKPGA
FDETVEQDGVTVLIDSKALFSIIGSEMDWAEDKLNQRFVFKNPNISKRIRFGT*
Coding >Ophun1|456
ATGATGGCCTCTCTCGCCGTGGCCCGCGCGGCCCTGCGACACTGTCGCCGTCACCCCACCGCCCGGCTTCTCCCG
ACGGTGCGAGTCGCATCGTACCACTCTTACCCGCTGCCGTCGAACGCGGCTCCGAACGCCGACGTGACCGAGACT
CCCATCGCGCAGCCTGAGCCGCTGCCGTCTCGACGCTATGACTCTCACGGTTCCGGGGCACAGCAGGTTGCCACG
CCCTCATCTGCGACTGGCGGCGCCGTGACGCCGAAGCAGAAATCTGTACGGCCGCGGACCAAGTTTCGCCCGCGA
AAGGCCGCCATGAGGCTGACGCCTGCTGCCGTCGAACGCTTGCGTCTTCTTCTCGATCAGCCGGAGCCAAAGCTG
ATCAAGGTGGGCGTGCGGAATCGGGGTTGCAGCGGACTGGCCTATCACCTCGAATACGTCGACAAGCCGGGAGCA
TTCGACGAGACGGTTGAGCAGGACGGTGTCACGGTTCTCATTGATAGCAAGGCTCTTTTCAGCATCATCGGCAGC
GAGATGGATTGGGCTGAGGACAAGTTGAACCAACGATTTGTCTTTAAGAACCCCAACATCAGTAAGCGCATCCGT
TTTGGGACTTGA
Transcript >Ophun1|456
ATGATGGCCTCTCTCGCCGTGGCCCGCGCGGCCCTGCGACACTGTCGCCGTCACCCCACCGCCCGGCTTCTCCCG
ACGGTGCGAGTCGCATCGTACCACTCTTACCCGCTGCCGTCGAACGCGGCTCCGAACGCCGACGTGACCGAGACT
CCCATCGCGCAGCCTGAGCCGCTGCCGTCTCGACGCTATGACTCTCACGGTTCCGGGGCACAGCAGGTTGCCACG
CCCTCATCTGCGACTGGCGGCGCCGTGACGCCGAAGCAGAAATCTGTACGGCCGCGGACCAAGTTTCGCCCGCGA
AAGGCCGCCATGAGGCTGACGCCTGCTGCCGTCGAACGCTTGCGTCTTCTTCTCGATCAGCCGGAGCCAAAGCTG
ATCAAGGTGGGCGTGCGGAATCGGGGTTGCAGCGGACTGGCCTATCACCTCGAATACGTCGACAAGCCGGGAGCA
TTCGACGAGACGGTTGAGCAGGACGGTGTCACGGTTCTCATTGATAGCAAGGCTCTTTTCAGCATCATCGGCAGC
GAGATGGATTGGGCTGAGGACAAGTTGAACCAACGATTTGTCTTTAAGAACCCCAACATCAGTAAGCGCATCCGT
TTTGGGACTTGA
Gene >Ophun1|456
ATGATGGCCTCTCTCGCCGTGGCCCGCGCGGCCCTGCGACACTGTCGCCGTCACCCCACCGCCCGGCTTCTCCCG
ACGGTGCGAGTCGCATCGTACCACTCTTACCCGCTGCCGTCGAACGCGGCTCCGAACGCCGACGTGACCGAGACT
CCCATCGCGCAGCCTGAGCCGCTGCCGTCTCGACGCTATGACTCTCACGGTTCCGGGGCACAGCAGGTTGCCACG
CCCTCATCTGCGACTGGCGGCGCCGTGACGCCGAAGCAGAAATCTGTACGGCCGCGGACCAAGTTTCGCCCGCGA
AAGGCCGCCATGAGGCTGACGCCTGCTGCCGTCGAACGCTTGCGTCTTCTTCTCGATCAGCCGGAGCCAAAGCTG
ATCAAGGTGGGCGTGCGGAATCGGGGTTGCAGCGGACTGGCCTATCACCTCGAATACGTCGACAAGCCGGGAGCA
TTCGACGAGACGGTTGAGCAGGACGGTGTCACGGTTCTCATTGATAGCAAGGCTCTTTTCAGCATCATCGGCAGC
GAGATGGATTGGGCTGAGGACAAGTTGAACCAACGATTTGTCTTTAAGAACCCCAACATCAGTAAGCGCATCCGT
TTTGGGACTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail