Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4554
Gene name
LocationContig_421:15345..16391
Strand+
Gene length (bp)1046
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00565 SNase Staphylococcal nuclease homologue 3.1E-23 144 253

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7YQ31|LCL3_NECH7 Probable endonuclease LCL3 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=LCL3 PE=3 SV=1 20 276 3.0E-126
sp|A4RMK0|LCL3_MAGO7 Probable endonuclease LCL3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=LCL3 PE=3 SV=2 19 277 2.0E-94
sp|C9SI22|LCL3_VERA1 Probable endonuclease LCL3 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=LCL3 PE=3 SV=1 20 273 1.0E-88
sp|A6RP27|LCL3_BOTFB Probable endonuclease lcl3 OS=Botryotinia fuckeliana (strain B05.10) GN=lcl3 PE=3 SV=1 24 271 3.0E-87
sp|A7ECE0|LCL3_SCLS1 Probable endonuclease lcl3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=lcl3 PE=3 SV=1 71 270 4.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7YQ31|LCL3_NECH7 Probable endonuclease LCL3 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=LCL3 PE=3 SV=1 20 276 3.0E-126
sp|A4RMK0|LCL3_MAGO7 Probable endonuclease LCL3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=LCL3 PE=3 SV=2 19 277 2.0E-94
sp|C9SI22|LCL3_VERA1 Probable endonuclease LCL3 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=LCL3 PE=3 SV=1 20 273 1.0E-88
sp|A6RP27|LCL3_BOTFB Probable endonuclease lcl3 OS=Botryotinia fuckeliana (strain B05.10) GN=lcl3 PE=3 SV=1 24 271 3.0E-87
sp|A7ECE0|LCL3_SCLS1 Probable endonuclease lcl3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=lcl3 PE=3 SV=1 71 270 4.0E-86
sp|E3QWM6|LCL3_COLGM Probable endonuclease LCL3 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=LCL3 PE=3 SV=1 20 268 4.0E-85
sp|C5P0Z4|LCL3_COCP7 Probable endonuclease LCL3 OS=Coccidioides posadasii (strain C735) GN=LCL3 PE=3 SV=1 51 275 2.0E-78
sp|C4JVW2|LCL3_UNCRE Probable endonuclease LCL3 OS=Uncinocarpus reesii (strain UAMH 1704) GN=LCL3 PE=3 SV=1 40 275 4.0E-77
sp|B2WC78|LCL3_PYRTR Probable endonuclease lcl3 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=lcl3 PE=3 SV=1 40 273 1.0E-76
sp|Q0UVH1|LCL3_PHANO Probable endonuclease LCL3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LCL3 PE=3 SV=2 37 271 3.0E-76
sp|C1GKM1|LCL3_PARBD Probable endonuclease LCL3 OS=Paracoccidioides brasiliensis (strain Pb18) GN=LCL3 PE=3 SV=1 56 275 5.0E-76
sp|C5FTB4|LCL3_ARTOC Probable endonuclease LCL3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=LCL3 PE=3 SV=1 60 268 7.0E-76
sp|C0SEQ8|LCL3_PARBP Probable endonuclease LCL3 OS=Paracoccidioides brasiliensis (strain Pb03) GN=LCL3 PE=3 SV=1 56 271 7.0E-76
sp|C1H492|LCL3_PARBA Probable endonuclease LCL3 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=LCL3 PE=3 SV=1 56 275 4.0E-75
sp|B2AU25|LCL3_PODAN Probable endonuclease LCL3 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=LCL3 PE=3 SV=1 57 253 5.0E-75
sp|B6QNP4|LCL3_TALMQ Probable endonuclease lcl3 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=lcl3 PE=3 SV=1 39 268 2.0E-74
sp|E4V094|LCL3_ARTGP Probable endonuclease LCL3 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=LCL3 PE=3 SV=1 60 268 1.0E-73
sp|B6H1W0|LCL3_PENRW Probable endonuclease lcl3 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lcl3 PE=3 SV=1 20 268 1.0E-73
sp|A1D4S1|LCL3_NEOFI Probable endonuclease lcl3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lcl3 PE=3 SV=1 60 274 2.0E-73
sp|Q0CUT8|LCL3_ASPTN Probable endonuclease lcl3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lcl3 PE=3 SV=1 55 268 3.0E-73
sp|A1CRW4|LCL3_ASPCL Probable endonuclease lcl3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=lcl3 PE=3 SV=1 60 274 3.0E-73
sp|Q4WK77|LCL3_ASPFU Probable endonuclease lcl3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lcl3 PE=3 SV=1 60 274 8.0E-73
sp|B0XMZ5|LCL3_ASPFC Probable endonuclease lcl3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lcl3 PE=3 SV=1 60 274 8.0E-73
sp|A2Q8K8|LCL3_ASPNC Probable endonuclease lcl3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lcl3 PE=3 SV=1 55 268 1.0E-72
sp|Q5BGS2|LCL3_EMENI Probable endonuclease lcl3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lcl3 PE=3 SV=1 20 275 4.0E-72
sp|Q2URN2|LCL3_ASPOR Probable endonuclease lcl3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lcl3 PE=3 SV=1 56 276 3.0E-71
sp|B8MY73|LCL3_ASPFN Probable endonuclease lcl3 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lcl3 PE=3 SV=1 56 276 3.0E-71
sp|E4ZVE5|LCL3_LEPMJ Probable endonuclease LCL3 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=LCL3 PE=3 SV=1 56 275 5.0E-71
sp|C5GB89|LCL3_AJEDR Probable endonuclease LCL3 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=LCL3 PE=3 SV=1 47 232 6.0E-70
sp|C4Y4X4|LCL3_CLAL4 Probable endonuclease LCL3 OS=Clavispora lusitaniae (strain ATCC 42720) GN=LCL3 PE=3 SV=1 74 266 5.0E-59
sp|C5MC60|LCL3_CANTT Probable endonuclease LCL3 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=LCL3 PE=3 SV=1 73 266 2.0E-58
sp|B9W9Z5|LCL3_CANDC Probable endonuclease LCL3 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=LCL3 PE=3 SV=1 46 266 2.0E-58
sp|Q6BSY9|LCL3_DEBHA Probable endonuclease LCL3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LCL3 PE=3 SV=2 62 266 6.0E-58
sp|C4YFU9|LCL3_CANAW Probable endonuclease LCL3 OS=Candida albicans (strain WO-1) GN=LCL3 PE=3 SV=1 48 266 2.0E-57
sp|Q5AKW3|LCL3_CANAL Probable endonuclease LCL3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LCL3 PE=3 SV=1 48 266 2.0E-57
sp|C4QW04|LCL3_PICPG Probable endonuclease LCL3 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=LCL3 PE=3 SV=1 69 269 3.0E-57
sp|A3GI61|LCL3_PICST Probable endonuclease LCL3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=LCL3 PE=3 SV=2 96 269 6.0E-57
sp|Q6FS62|LCL3_CANGA Probable endonuclease LCL3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LCL3 PE=3 SV=1 75 269 9.0E-57
sp|A5DNZ8|LCL3_PICGU Probable endonuclease LCL3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=LCL3 PE=3 SV=1 71 269 1.0E-56
sp|Q6C427|LCL3_YARLI Probable endonuclease LCL3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LCL3 PE=3 SV=1 69 266 4.0E-53
sp|C5DZY8|LCL3_ZYGRC Probable endonuclease LCL3 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=LCL3 PE=3 SV=1 62 266 1.0E-51
sp|A5E1Q5|LCL3_LODEL Probable endonuclease LCL3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LCL3 PE=3 SV=1 86 269 1.0E-47
sp|B6JYT1|LCL3_SCHJY Probable endonuclease lcl3 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=lcl3 PE=3 SV=1 79 268 3.0E-47
sp|D8QGA7|LCL3_SCHCM Probable endonuclease LCL3 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=LCL3 PE=3 SV=1 60 270 2.0E-46
sp|A7TE94|LCL3_VANPO Probable endonuclease LCL3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=LCL3 PE=3 SV=1 59 268 2.0E-45
sp|B5VIN9|LCL3_YEAS6 Probable endonuclease LCL3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=LCL3 PE=3 SV=1 69 268 4.0E-44
sp|P53153|LCL3_YEAST Probable endonuclease LCL3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCL3 PE=1 SV=1 59 268 5.0E-44
sp|A6ZU94|LCL3_YEAS7 Probable endonuclease LCL3 OS=Saccharomyces cerevisiae (strain YJM789) GN=LCL3 PE=3 SV=1 59 268 5.0E-44
sp|C7GW31|LCL3_YEAS2 Probable endonuclease LCL3 OS=Saccharomyces cerevisiae (strain JAY291) GN=LCL3 PE=3 SV=1 59 268 5.0E-44
sp|B3LHF1|LCL3_YEAS1 Probable endonuclease LCL3 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=LCL3 PE=3 SV=1 59 268 5.0E-44
sp|C8Z8G3|LCL3_YEAS8 Probable endonuclease LCL3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=LCL3 PE=3 SV=1 59 268 5.0E-44
sp|Q754Z2|LCL3_ASHGO Probable endonuclease LCL3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LCL3 PE=3 SV=1 59 272 2.0E-43
sp|C5E2G4|LCL3_LACTC Probable endonuclease LCL3 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=LCL3 PE=3 SV=1 69 268 1.0E-42
sp|B0D7T0|LCL3_LACBS Probable endonuclease LCL3 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LCL3 PE=3 SV=1 62 271 6.0E-42
sp|Q6CMM1|LCL3_KLULA Probable endonuclease LCL3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LCL3 PE=3 SV=1 61 268 2.0E-41
sp|E6R427|LCL3_CRYGW Probable endonuclease LCL3 OS=Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) GN=LCL3 PE=3 SV=1 65 268 1.0E-40
sp|Q874L8|LCL3_KLUDE Probable endonuclease LCL3 OS=Kluyveromyces delphensis GN=LCL3 PE=3 SV=1 75 268 5.0E-40
sp|O60168|LCL3_SCHPO Probable endonuclease C19F8.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19F8.04c PE=3 SV=1 86 253 1.0E-39
sp|Q57519|Y1296_HAEIN Uncharacterized endonuclease HI_1296 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1296 PE=3 SV=1 101 253 9.0E-08
sp|Q942N7|CAN1_ORYSJ Probable staphylococcal-like nuclease CAN1 OS=Oryza sativa subsp. japonica GN=Os01g0166100 PE=2 SV=1 128 266 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5637
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4913
Ophiocordyceps australis map64 (Brazil) OphauB2|345
Ophiocordyceps camponoti-floridani Ophcf2|04373
Ophiocordyceps camponoti-rufipedis Ophun1|4554 (this protein)
Ophiocordyceps kimflemingae Ophio5|354
Ophiocordyceps subramaniannii Hirsu2|7850

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4554
MTCTRDVGRCTAAASSSNIMVWPFGSSGPSEPPPRKRPFEWSEALVPPGDQWEAVREWAPLVMFSLFGMGALQLY
AHFLRRIPGADYIRPSYFRTRSLYGRVTSVGDGDNFHFFHTPGGRAVGWGWLRRVPRERKELKDRTIPIRIAGVD
APEGAHFGRPGQPFAADALTWLSDYILHRDVRAYVYRRDQYNRIVATVYVRRWMIRRDVGLEMLKRGLATVYESK
TAAEFGGMRGKYEKAEAKAKAQKKGMWSGKPSHYQSPGEYKAKYAGQQAQSVK*
Coding >Ophun1|4554
ATGACCTGCACTCGGGACGTAGGGCGCTGCACAGCGGCGGCCAGCAGCAGCAACATCATGGTATGGCCGTTCGGA
TCATCGGGCCCCAGCGAGCCACCGCCGAGGAAGCGGCCCTTTGAATGGTCCGAAGCACTCGTCCCGCCCGGGGAT
CAATGGGAGGCGGTGAGAGAATGGGCGCCTCTGGTCATGTTCTCGCTCTTCGGGATGGGAGCCCTACAGCTGTAC
GCGCACTTCCTGCGACGGATTCCGGGAGCCGACTACATCCGGCCGTCGTACTTTCGGACGAGGAGTCTGTATGGG
AGGGTCACCAGCGTCGGCGACGGAGACAACTTTCACTTCTTTCACACGCCTGGAGGGAGGGCTGTTGGCTGGGGA
TGGCTGCGAAGGGTGCCGCGGGAGAGGAAGGAGCTCAAAGACCGCACGATACCCATCCGAATCGCCGGCGTCGAC
GCCCCCGAGGGAGCCCACTTTGGCCGGCCGGGGCAGCCGTTCGCGGCCGATGCCCTGACGTGGCTGTCTGATTAC
ATCTTGCACCGCGACGTGCGGGCGTACGTCTACCGCCGAGACCAGTACAACCGCATCGTAGCGACCGTCTACGTT
CGGCGGTGGATGATACGGCGCGACGTCGGGCTGGAGATGCTGAAGCGAGGGCTGGCGACGGTCTACGAGTCCAAG
ACGGCGGCCGAGTTTGGCGGGATGAGGGGAAAGTACGAAAAGGCCGAGGCCAAGGCCAAGGCTCAGAAGAAGGGT
ATGTGGTCTGGCAAGCCGAGCCATTATCAGAGCCCGGGCGAGTACAAGGCGAAATATGCCGGCCAACAGGCGCAG
TCGGTCAAGTGA
Transcript >Ophun1|4554
ATGACCTGCACTCGGGACGTAGGGCGCTGCACAGCGGCGGCCAGCAGCAGCAACATCATGGTATGGCCGTTCGGA
TCATCGGGCCCCAGCGAGCCACCGCCGAGGAAGCGGCCCTTTGAATGGTCCGAAGCACTCGTCCCGCCCGGGGAT
CAATGGGAGGCGGTGAGAGAATGGGCGCCTCTGGTCATGTTCTCGCTCTTCGGGATGGGAGCCCTACAGCTGTAC
GCGCACTTCCTGCGACGGATTCCGGGAGCCGACTACATCCGGCCGTCGTACTTTCGGACGAGGAGTCTGTATGGG
AGGGTCACCAGCGTCGGCGACGGAGACAACTTTCACTTCTTTCACACGCCTGGAGGGAGGGCTGTTGGCTGGGGA
TGGCTGCGAAGGGTGCCGCGGGAGAGGAAGGAGCTCAAAGACCGCACGATACCCATCCGAATCGCCGGCGTCGAC
GCCCCCGAGGGAGCCCACTTTGGCCGGCCGGGGCAGCCGTTCGCGGCCGATGCCCTGACGTGGCTGTCTGATTAC
ATCTTGCACCGCGACGTGCGGGCGTACGTCTACCGCCGAGACCAGTACAACCGCATCGTAGCGACCGTCTACGTT
CGGCGGTGGATGATACGGCGCGACGTCGGGCTGGAGATGCTGAAGCGAGGGCTGGCGACGGTCTACGAGTCCAAG
ACGGCGGCCGAGTTTGGCGGGATGAGGGGAAAGTACGAAAAGGCCGAGGCCAAGGCCAAGGCTCAGAAGAAGGGT
ATGTGGTCTGGCAAGCCGAGCCATTATCAGAGCCCGGGCGAGTACAAGGCGAAATATGCCGGCCAACAGGCGCAG
TCGGTCAAGTGA
Gene >Ophun1|4554
ATGACCTGCACTCGGGACGTAGGGTAGGCGATATCCGCATCCTGCTACCCTGGACCACCACATCCCATCACAACA
CAACATCGCTGCCCACCCCGAGCGGGGAGCACGTCACTGCGGCCGACCATCCAAGCTCACGGCGACAAGGCGCTG
CACAGCGGCGGCCAGCAGCAGCAACATCATGGTATGGCCGTTCGGATCATCGGGCCCCAGCGAGCCACCGCCGAG
GAAGCGGCCCTTTGAATGGTCCGAAGCACTCGTCCCGCCCGGGGATCAATGGGAGGCGGTGAGAGAATGGGCGCC
TCTGGTCATGTTCTCGCTCTTCGGGATGGGAGCCCTACAGCTGTACGCGCACTTCCTGCGACGGATTCCGGGAGC
CGACTACATCCGGCCGTCGTACTTTCGGACGAGGAGTCTGTATGGGAGGGTCACCAGCGTCGGCGACGGAGACAA
CTTTCACTTCTTTCACACGCCTGGAGGGAGGGCTGTTGGCTGGGGATGGCTGCGAAGGGTGCCGCGGGAGAGGAA
GGAGCTCAAAGACCGCACGGTATGACCTCGAGCGTCCGGGAGCGCCCAGAGTTGCCCTTGAGATCTGATCCCCTT
CCCCTTGGGGCGGCTGACGAGCGGACGAGCAGATACCCATCCGAATCGCCGGCGTCGACGCCCCCGAGGGAGCCC
ACTTTGGCCGGCCGGGGCAGCCGTTCGCGGCCGATGCCCTGACGTGGCTGTCTGATTACATCTTGCACCGCGACG
TGCGGGCGTACGTCTACCGCCGAGACCAGTACAACCGCATCGTAGCGACCGTCTACGTTCGGCGGTGGATGATAC
GGCGCGACGTCGGGCTGGAGATGCTGAAGCGAGGGCTGGCGACGGTCTACGAGTCCAAGACGGCGGCCGAGTTTG
GCGGGATGAGGGGAAAGTACGAAAAGGCCGAGGCCAAGGCCAAGGCTCAGAAGAAGGGTATGTGGTCTGGCAAGC
CGAGCCATTATCAGAGCCCGGGCGAGTACAAGGCGAAATATGCCGGCCAACAGGCGCAGTCGGTCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail