Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4552
Gene name
LocationContig_421:10180..13644
Strand-
Gene length (bp)3464
Transcript length (bp)3045
Coding sequence length (bp)3045
Protein length (aa) 1015

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 1.2E-04 103 136
PF00400 WD40 WD domain, G-beta repeat 1.4E-01 143 199
PF00400 WD40 WD domain, G-beta repeat 4.3E-03 418 450
PF00400 WD40 WD domain, G-beta repeat 2.3E-05 498 532
PF00400 WD40 WD domain, G-beta repeat 1.4E-03 599 630
PF00400 WD40 WD domain, G-beta repeat 3.6E-02 637 678
PF00400 WD40 WD domain, G-beta repeat 4.9E-05 684 719
PF04003 Utp12 Dip2/Utp12 Family 1.8E-17 828 928
PF01423 LSM LSM domain 3.5E-11 945 986

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87177|YB1C_SCHPO Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.12 PE=1 SV=1 1 928 0.0E+00
sp|Q12220|UTP12_YEAST U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 1 942 0.0E+00
sp|Q9UNX4|WDR3_HUMAN WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 1 928 0.0E+00
sp|Q8BHB4|WDR3_MOUSE WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 1 928 0.0E+00
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 358 946 4.0E-150
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87177|YB1C_SCHPO Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.12 PE=1 SV=1 1 928 0.0E+00
sp|Q12220|UTP12_YEAST U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 1 942 0.0E+00
sp|Q9UNX4|WDR3_HUMAN WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 1 928 0.0E+00
sp|Q8BHB4|WDR3_MOUSE WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 1 928 0.0E+00
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 358 946 4.0E-150
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 42 688 2.0E-39
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 77 722 1.0E-38
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 1 243 6.0E-36
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 23 688 6.0E-36
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 116 720 2.0E-34
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 393 723 2.0E-33
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 400 722 1.0E-32
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 419 719 4.0E-32
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 419 727 8.0E-32
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 405 722 1.0E-30
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 419 719 3.0E-30
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 104 720 9.0E-30
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 419 719 5.0E-29
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 419 719 5.0E-29
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 419 719 7.0E-29
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 419 720 1.0E-28
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 409 720 9.0E-28
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 409 720 9.0E-28
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 77 725 1.0E-27
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 412 722 4.0E-27
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 419 719 6.0E-27
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 422 720 6.0E-27
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 425 719 1.0E-26
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 421 725 2.0E-26
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 422 719 2.0E-26
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 419 719 2.0E-26
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 421 725 3.0E-26
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 400 689 3.0E-25
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 484 720 3.0E-25
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 419 720 3.0E-25
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 419 727 3.0E-24
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 473 727 3.0E-23
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 367 720 9.0E-23
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 396 720 9.0E-23
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 446 724 9.0E-23
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 419 677 1.0E-22
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 465 738 1.0E-22
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 473 727 4.0E-22
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 467 720 5.0E-22
sp|Q6GMD2|WDR61_XENLA WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 472 720 2.0E-21
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 465 720 2.0E-21
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 463 722 4.0E-21
sp|Q5ZJH5|WDR61_CHICK WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 485 720 4.0E-21
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 93 532 5.0E-21
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 63 719 6.0E-21
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 415 678 7.0E-21
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 414 799 7.0E-21
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 419 680 1.0E-20
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 419 680 1.0E-20
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 419 680 1.0E-20
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 419 680 1.0E-20
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 419 677 2.0E-20
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 402 799 3.0E-20
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 415 733 4.0E-20
sp|Q9SZQ5|VIP3_ARATH WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 445 711 6.0E-20
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 519 751 7.0E-20
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 419 680 7.0E-20
sp|Q6PBD6|WDR61_XENTR WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 472 720 9.0E-20
sp|Q9GZS3|WDR61_HUMAN WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 485 720 1.0E-19
sp|Q32LN7|WDR61_BOVIN WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 484 720 1.0E-19
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 392 679 2.0E-19
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 499 729 2.0E-19
sp|Q4V7A0|WDR61_RAT WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 484 720 2.0E-19
sp|Q9ERF3|WDR61_MOUSE WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 484 720 2.0E-19
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 468 720 3.0E-19
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 425 751 3.0E-19
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 419 680 4.0E-19
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 421 680 5.0E-19
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 426 725 6.0E-19
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 419 677 6.0E-19
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 419 680 7.0E-19
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 492 720 8.0E-19
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 551 727 9.0E-19
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 470 725 9.0E-19
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 410 730 1.0E-18
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 501 720 1.0E-18
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 519 739 1.0E-18
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 419 677 1.0E-18
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 501 720 2.0E-18
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 419 752 2.0E-18
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 469 722 2.0E-18
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 40 306 3.0E-18
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 414 720 3.0E-18
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 502 720 3.0E-18
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 498 726 4.0E-18
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 419 633 4.0E-18
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 564 719 4.0E-18
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 468 737 4.0E-18
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 406 724 4.0E-18
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 414 799 5.0E-18
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 375 720 6.0E-18
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 414 730 6.0E-18
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 469 726 6.0E-18
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 496 722 6.0E-18
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 548 722 7.0E-18
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 23 533 8.0E-18
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 419 720 9.0E-18
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 564 725 1.0E-17
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 564 725 1.0E-17
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 564 725 1.0E-17
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 564 725 1.0E-17
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 393 726 1.0E-17
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 418 671 1.0E-17
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 564 725 1.0E-17
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 425 751 1.0E-17
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 409 720 2.0E-17
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 409 720 2.0E-17
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 409 720 2.0E-17
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 409 720 2.0E-17
sp|Q54D08|LST8_DICDI Protein LST8 homolog OS=Dictyostelium discoideum GN=lst8 PE=1 SV=1 407 653 2.0E-17
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 414 720 2.0E-17
sp|Q9Y6I7|WSB1_HUMAN WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 554 729 2.0E-17
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 392 719 3.0E-17
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 392 719 3.0E-17
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 418 712 3.0E-17
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 414 730 4.0E-17
sp|Q54D08|LST8_DICDI Protein LST8 homolog OS=Dictyostelium discoideum GN=lst8 PE=1 SV=1 437 720 5.0E-17
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 456 720 5.0E-17
sp|Q6P1V3|WSB1_XENTR WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 554 729 5.0E-17
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 418 681 6.0E-17
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 375 720 7.0E-17
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 418 681 7.0E-17
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 375 720 7.0E-17
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 375 720 7.0E-17
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 375 720 7.0E-17
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 375 720 7.0E-17
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 392 719 7.0E-17
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 469 720 8.0E-17
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 469 720 8.0E-17
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 501 727 9.0E-17
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 409 726 1.0E-16
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 472 721 1.0E-16
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 375 720 1.0E-16
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 392 719 1.0E-16
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 375 720 1.0E-16
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 470 720 1.0E-16
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 375 720 1.0E-16
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 470 720 1.0E-16
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 375 720 1.0E-16
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 564 719 2.0E-16
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 393 720 2.0E-16
sp|Q55DA2|CIAO1_DICDI Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 496 748 2.0E-16
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 501 720 2.0E-16
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 419 720 2.0E-16
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 475 723 2.0E-16
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 395 719 3.0E-16
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 415 680 3.0E-16
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 414 735 3.0E-16
sp|C7Z6H2|LIS1_NECH7 Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 467 796 3.0E-16
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 499 720 3.0E-16
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 564 727 4.0E-16
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 497 735 4.0E-16
sp|Q54YD8|COPB2_DICDI Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 437 713 4.0E-16
sp|Q9W5Z5|WSB1_TAKRU WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 554 729 5.0E-16
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 415 730 5.0E-16
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 495 721 5.0E-16
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 502 720 5.0E-16
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 375 720 5.0E-16
sp|Q7T2F6|WSB1_DANRE WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 554 729 5.0E-16
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 419 649 6.0E-16
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 470 720 7.0E-16
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 564 727 8.0E-16
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 450 695 8.0E-16
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 469 720 8.0E-16
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 403 719 9.0E-16
sp|O54927|WSB1_MOUSE WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 554 729 9.0E-16
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 419 720 9.0E-16
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 470 720 9.0E-16
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 419 685 1.0E-15
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 566 719 1.0E-15
sp|P38011|GBLP_YEAST Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 582 739 1.0E-15
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 375 720 1.0E-15
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 418 681 1.0E-15
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 470 725 1.0E-15
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 375 720 1.0E-15
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 470 727 1.0E-15
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 470 720 1.0E-15
sp|Q05946|UTP13_YEAST U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 563 750 1.0E-15
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 503 729 1.0E-15
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 418 681 1.0E-15
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 476 739 2.0E-15
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 470 727 2.0E-15
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 415 695 2.0E-15
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 416 634 2.0E-15
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 470 727 2.0E-15
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 470 727 2.0E-15
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 470 725 2.0E-15
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 470 720 2.0E-15
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 470 727 2.0E-15
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 97 531 2.0E-15
sp|Q26544|WSL17_SCHMA WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 418 674 2.0E-15
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 470 720 2.0E-15
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 470 720 2.0E-15
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 423 720 2.0E-15
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 418 633 2.0E-15
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 470 725 2.0E-15
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 470 720 2.0E-15
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 469 739 3.0E-15
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 561 727 3.0E-15
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 470 727 3.0E-15
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 470 727 3.0E-15
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 470 727 3.0E-15
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 470 727 3.0E-15
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 470 727 3.0E-15
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 419 756 3.0E-15
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 470 720 3.0E-15
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 470 720 3.0E-15
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 470 720 3.0E-15
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 469 722 3.0E-15
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 450 678 4.0E-15
sp|P38203|LSM2_YEAST U6 snRNA-associated Sm-like protein LSm2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSM2 PE=1 SV=1 945 993 4.0E-15
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 470 720 4.0E-15
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 470 720 4.0E-15
sp|Q7S7L4|LIS12_NEUCR Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 467 764 4.0E-15
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 434 719 4.0E-15
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 469 739 5.0E-15
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 561 727 5.0E-15
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 397 726 5.0E-15
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 470 727 5.0E-15
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 598 720 5.0E-15
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 469 722 5.0E-15
sp|P20053|PRP4_YEAST U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 410 719 5.0E-15
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 392 720 6.0E-15
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 434 720 6.0E-15
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 470 720 6.0E-15
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 496 723 7.0E-15
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 475 727 7.0E-15
sp|P35605|COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 437 714 7.0E-15
sp|O94408|LSM2_SCHPO U6 snRNA-associated Sm-like protein LSm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsm2 PE=3 SV=1 945 993 7.0E-15
sp|O55029|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 437 714 7.0E-15
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 33 254 8.0E-15
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 416 634 8.0E-15
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 599 720 8.0E-15
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 470 727 8.0E-15
sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 437 714 8.0E-15
sp|Q5R664|COPB2_PONAB Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 437 714 8.0E-15
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 503 729 9.0E-15
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 375 720 9.0E-15
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 564 720 1.0E-14
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 419 679 1.0E-14
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 402 726 1.0E-14
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 475 727 1.0E-14
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 470 727 1.0E-14
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 392 720 1.0E-14
sp|Q7ZVA0|SMU1_DANRE WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 514 683 1.0E-14
sp|D1ZEM6|LIS12_SORMK Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 467 782 1.0E-14
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 97 531 1.0E-14
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 419 720 1.0E-14
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 496 720 2.0E-14
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 469 731 2.0E-14
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 598 824 2.0E-14
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 419 720 2.0E-14
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 419 649 2.0E-14
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 375 720 2.0E-14
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 566 728 2.0E-14
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 395 720 2.0E-14
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 599 720 2.0E-14
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 499 724 2.0E-14
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 97 531 2.0E-14
sp|Q7PS24|CIAO1_ANOGA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 496 721 2.0E-14
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 496 720 3.0E-14
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 598 720 3.0E-14
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 470 720 3.0E-14
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 470 727 3.0E-14
sp|P83774|GBLP_CANAL Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 499 739 3.0E-14
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 499 739 3.0E-14
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 499 796 3.0E-14
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 97 531 3.0E-14
sp|Q4R4I8|COPB2_MACFA Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 437 714 3.0E-14
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 482 720 3.0E-14
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 419 720 3.0E-14
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 407 720 4.0E-14
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 392 720 4.0E-14
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 467 782 4.0E-14
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 434 720 4.0E-14
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 400 721 5.0E-14
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 566 720 5.0E-14
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 470 725 5.0E-14
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 599 720 5.0E-14
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 409 719 5.0E-14
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 419 720 5.0E-14
sp|P52287|GBB3_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 419 720 5.0E-14
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 499 796 5.0E-14
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 499 720 5.0E-14
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 499 720 5.0E-14
sp|P16520|GBB3_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 419 720 6.0E-14
sp|Q9W328|LST8_DROME Protein LST8 homolog OS=Drosophila melanogaster GN=Lst8 PE=2 SV=2 354 653 6.0E-14
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 426 727 6.0E-14
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 419 720 7.0E-14
sp|O35142|COPB2_RAT Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 437 714 7.0E-14
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 496 721 7.0E-14
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 569 725 8.0E-14
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 561 727 8.0E-14
sp|B3MC74|CIAO1_DROAN Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 495 720 8.0E-14
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 470 727 9.0E-14
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 496 727 1.0E-13
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 496 723 1.0E-13
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 411 633 1.0E-13
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 597 722 1.0E-13
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 81 303 1.0E-13
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 467 731 1.0E-13
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 475 727 1.0E-13
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 475 727 1.0E-13
sp|Q6ZMY6|WDR88_HUMAN WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 419 724 1.0E-13
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 499 724 1.0E-13
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 474 720 1.0E-13
sp|Q5I0B4|LST8_XENTR Target of rapamycin complex subunit lst8 OS=Xenopus tropicalis GN=mlst8 PE=2 SV=1 417 653 1.0E-13
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 434 720 1.0E-13
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 434 720 1.0E-13
sp|Q6PA72|LST8_XENLA Target of rapamycin complex subunit lst8 OS=Xenopus laevis GN=mlst8 PE=2 SV=1 417 653 1.0E-13
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 496 727 2.0E-13
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 499 722 2.0E-13
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 419 740 2.0E-13
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 419 720 2.0E-13
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 474 720 2.0E-13
sp|Q61011|GBB3_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 419 720 2.0E-13
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 470 720 2.0E-13
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 419 720 2.0E-13
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 426 719 2.0E-13
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 500 720 2.0E-13
sp|O42937|COPB2_SCHPO Probable coatomer subunit beta' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec27 PE=3 SV=2 418 714 2.0E-13
sp|O80990|CIA1_ARATH Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 497 719 2.0E-13
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 495 720 2.0E-13
sp|P27612|PLAP_MOUSE Phospholipase A-2-activating protein OS=Mus musculus GN=Plaa PE=1 SV=4 415 793 2.0E-13
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 499 720 3.0E-13
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 419 724 3.0E-13
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 407 720 3.0E-13
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 563 722 3.0E-13
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 564 729 3.0E-13
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 409 719 3.0E-13
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 409 719 3.0E-13
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 434 720 3.0E-13
sp|O62621|COPB2_DROME Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 437 714 3.0E-13
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 564 720 3.0E-13
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 564 729 4.0E-13
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 426 720 4.0E-13
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 434 720 4.0E-13
sp|Q4ICM0|LIS1_GIBZE Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 467 796 4.0E-13
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 455 728 5.0E-13
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 564 729 5.0E-13
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 564 729 5.0E-13
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 419 719 5.0E-13
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 500 720 5.0E-13
sp|Q6GM65|PLAP_XENLA Phospholipase A-2-activating protein OS=Xenopus laevis GN=plaa PE=2 SV=2 410 761 5.0E-13
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 431 719 5.0E-13
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 500 724 5.0E-13
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 562 743 5.0E-13
sp|P79147|GBB3_CANLF Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 419 720 5.0E-13
sp|Q292E8|CIAO1_DROPS Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 499 719 5.0E-13
sp|P87060|POP1_SCHPO WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 474 719 5.0E-13
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 478 739 6.0E-13
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 500 720 6.0E-13
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 418 675 6.0E-13
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 426 720 6.0E-13
sp|B4GDM7|CIAO1_DROPE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 499 719 6.0E-13
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 500 796 6.0E-13
sp|Q6PH57|GBB1_DANRE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 475 720 6.0E-13
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 499 722 7.0E-13
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 475 727 7.0E-13
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 499 722 7.0E-13
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 419 720 7.0E-13
sp|Q9BVC4|LST8_HUMAN Target of rapamycin complex subunit LST8 OS=Homo sapiens GN=MLST8 PE=1 SV=1 417 653 7.0E-13
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 419 720 8.0E-13
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 407 679 8.0E-13
sp|Q26544|WSL17_SCHMA WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 485 720 8.0E-13
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 417 681 8.0E-13
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 499 724 8.0E-13
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 500 724 8.0E-13
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 564 720 8.0E-13
sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 475 720 8.0E-13
sp|P62880|GBB2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 475 720 8.0E-13
sp|P62879|GBB2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 475 720 8.0E-13
sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 475 720 8.0E-13
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 486 722 9.0E-13
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 569 723 9.0E-13
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 463 720 9.0E-13
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 562 743 9.0E-13
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 562 743 9.0E-13
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 499 724 9.0E-13
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 599 720 1.0E-12
sp|P38011|GBLP_YEAST Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 87 304 1.0E-12
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 419 720 1.0E-12
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 407 679 1.0E-12
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 419 720 1.0E-12
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 407 679 1.0E-12
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 419 720 1.0E-12
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 574 729 1.0E-12
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 407 679 1.0E-12
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 407 679 1.0E-12
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 407 679 1.0E-12
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 407 679 1.0E-12
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 407 679 1.0E-12
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 564 737 1.0E-12
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 500 724 1.0E-12
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 500 724 1.0E-12
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 492 706 1.0E-12
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 463 720 1.0E-12
sp|Q9DCJ1|LST8_MOUSE Target of rapamycin complex subunit LST8 OS=Mus musculus GN=Mlst8 PE=1 SV=1 417 653 1.0E-12
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 405 724 1.0E-12
sp|Q86TI4|WDR86_HUMAN WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 472 719 1.0E-12
sp|Q17QU5|LST8_BOVIN Target of rapamycin complex subunit LST8 OS=Bos taurus GN=MLST8 PE=2 SV=1 417 653 1.0E-12
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 463 720 1.0E-12
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 467 776 1.0E-12
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 499 796 1.0E-12
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 467 719 1.0E-12
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 499 722 2.0E-12
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 419 740 2.0E-12
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 408 638 2.0E-12
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 437 653 2.0E-12
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 412 726 2.0E-12
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 467 720 2.0E-12
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 492 706 2.0E-12
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 407 679 2.0E-12
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 419 720 2.0E-12
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 596 723 2.0E-12
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 562 743 2.0E-12
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 499 719 2.0E-12
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 499 724 2.0E-12
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 499 719 2.0E-12
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 467 719 2.0E-12
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 564 720 2.0E-12
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 419 720 2.0E-12
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 499 796 2.0E-12
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 467 776 2.0E-12
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 562 731 2.0E-12
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 467 776 2.0E-12
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 562 731 2.0E-12
sp|B4LJT7|CIAO1_DROVI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 499 719 2.0E-12
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 414 722 2.0E-12
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 583 728 3.0E-12
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 103 306 3.0E-12
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 407 679 3.0E-12
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 419 720 3.0E-12
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 419 720 3.0E-12
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 419 720 3.0E-12
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 419 720 3.0E-12
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 419 720 3.0E-12
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 426 689 3.0E-12
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 562 731 3.0E-12
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 513 719 3.0E-12
sp|P74598|Y1491_SYNY3 Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 465 725 3.0E-12
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 514 683 3.0E-12
sp|B4MY77|CIAO1_DROWI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 499 719 3.0E-12
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 514 683 3.0E-12
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 79 306 4.0E-12
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 81 303 4.0E-12
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 407 679 4.0E-12
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 492 746 4.0E-12
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 497 739 4.0E-12
sp|B6K1G6|CFD1_SCHJY Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 488 721 4.0E-12
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 514 683 4.0E-12
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 514 683 4.0E-12
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 514 683 4.0E-12
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 514 683 4.0E-12
sp|P54319|PLAP_RAT Phospholipase A-2-activating protein OS=Rattus norvegicus GN=Plaa PE=1 SV=3 415 744 4.0E-12
sp|B3NQR5|CIAO1_DROER Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 499 720 4.0E-12
sp|Q803V5|LST8_DANRE Target of rapamycin complex subunit lst8 OS=Danio rerio GN=mlst8 PE=2 SV=1 417 653 4.0E-12
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 514 683 4.0E-12
sp|Q9I9H8|APAF_DANRE Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1 426 730 4.0E-12
sp|C4JZS6|LIS11_UNCRE Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 491 724 4.0E-12
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 419 736 5.0E-12
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 418 655 5.0E-12
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 421 721 5.0E-12
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 409 677 5.0E-12
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 477 720 5.0E-12
sp|Q6H8D6|COB23_ORYSJ Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 437 714 5.0E-12
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 562 722 6.0E-12
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 80 304 6.0E-12
sp|Q9SJT9|COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 469 722 6.0E-12
sp|P53699|CDC4_CANAX Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1 474 720 6.0E-12
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 68 630 7.0E-12
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 81 303 7.0E-12
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 502 720 7.0E-12
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 499 722 7.0E-12
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 407 679 7.0E-12
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 499 722 7.0E-12
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 561 723 7.0E-12
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 537 731 7.0E-12
sp|Q9HAV0|GBB4_HUMAN Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 475 720 7.0E-12
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 419 643 7.0E-12
sp|Q29HG9|LST8_DROPS Protein LST8 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA15597 PE=3 SV=1 356 653 7.0E-12
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 497 720 7.0E-12
sp|Q9Z2K5|LST8_RAT Target of rapamycin complex subunit LST8 OS=Rattus norvegicus GN=Mlst8 PE=1 SV=2 417 653 7.0E-12
sp|Q9CAA0|COB21_ARATH Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 437 714 7.0E-12
sp|Q1H595|LSM2_ARATH Sm-like protein LSM2 OS=Arabidopsis thaliana GN=LSM2 PE=1 SV=1 945 994 7.0E-12
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 467 713 8.0E-12
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 419 720 8.0E-12
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 597 720 8.0E-12
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 597 720 8.0E-12
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 597 720 8.0E-12
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 419 633 8.0E-12
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 467 711 8.0E-12
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 467 727 8.0E-12
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 569 729 9.0E-12
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 426 689 9.0E-12
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 470 678 9.0E-12
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 431 720 9.0E-12
sp|Q9C270|PWP2_NEUCR Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 417 603 9.0E-12
sp|Q8L828|COB23_ARATH Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 437 714 9.0E-12
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 597 720 1.0E-11
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 597 720 1.0E-11
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 492 746 1.0E-11
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 402 692 1.0E-11
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 534 722 1.0E-11
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 500 720 1.0E-11
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 469 720 1.0E-11
sp|Q6H8D5|COB22_ORYSJ Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 437 714 1.0E-11
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 400 681 1.0E-11
sp|P69104|GBLP_TRYBR Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 395 724 1.0E-11
sp|P69103|GBLP_TRYBB Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 395 724 1.0E-11
sp|P87314|HIR1_SCHPO Protein hir1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hip1 PE=1 SV=1 501 690 1.0E-11
sp|A0AUS0|WSDU1_DANRE WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 423 635 1.0E-11
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 21 501 2.0E-11
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 562 725 2.0E-11
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 499 722 2.0E-11
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 499 722 2.0E-11
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 499 722 2.0E-11
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 499 722 2.0E-11
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 499 722 2.0E-11
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 499 722 2.0E-11
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 499 722 2.0E-11
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 416 638 2.0E-11
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 599 722 2.0E-11
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 417 681 2.0E-11
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 451 723 2.0E-11
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 534 722 2.0E-11
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 343 721 2.0E-11
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 409 719 2.0E-11
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 469 677 2.0E-11
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 412 719 2.0E-11
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 514 683 2.0E-11
sp|Q9Y263|PLAP_HUMAN Phospholipase A-2-activating protein OS=Homo sapiens GN=PLAA PE=1 SV=2 415 744 2.0E-11
sp|B4KRQ4|WDR48_DROMO WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 402 731 2.0E-11
sp|O35900|LSM2_MOUSE U6 snRNA-associated Sm-like protein LSm2 OS=Mus musculus GN=Lsm2 PE=1 SV=1 945 994 2.0E-11
sp|Q9Y333|LSM2_HUMAN U6 snRNA-associated Sm-like protein LSm2 OS=Homo sapiens GN=LSM2 PE=1 SV=1 945 994 2.0E-11
sp|Q09150|REC14_SCHPO Meiotic recombination protein rec14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rec14 PE=3 SV=1 399 717 2.0E-11
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 407 720 2.0E-11
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 463 720 2.0E-11
sp|Q9C827|COB22_ARATH Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 437 714 2.0E-11
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 87 243 3.0E-11
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 499 722 3.0E-11
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 500 701 3.0E-11
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 392 679 3.0E-11
sp|Q05946|UTP13_YEAST U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 117 677 3.0E-11
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 392 679 3.0E-11
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 564 729 3.0E-11
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 492 706 3.0E-11
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 500 720 3.0E-11
sp|P74598|Y1491_SYNY3 Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 429 722 3.0E-11
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 562 731 3.0E-11
sp|B6GZD3|LIS12_PENRW Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 467 724 3.0E-11
sp|B4QFZ8|CIAO1_DROSI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 499 720 3.0E-11
sp|Q7K1Y4|CIAO1_DROME Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 499 719 3.0E-11
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 562 725 4.0E-11
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 499 722 4.0E-11
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 415 740 4.0E-11
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 422 717 4.0E-11
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 499 722 4.0E-11
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 499 722 4.0E-11
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 392 679 4.0E-11
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 499 722 4.0E-11
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 534 722 4.0E-11
sp|Q6PH57|GBB1_DANRE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 419 720 4.0E-11
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 407 720 4.0E-11
sp|Q94A40|COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 469 722 4.0E-11
sp|P79959|GBB1_XENLA Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 475 720 4.0E-11
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 407 720 4.0E-11
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 407 720 4.0E-11
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 28 208 5.0E-11
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 574 729 5.0E-11
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 564 729 5.0E-11
sp|B4P7H8|WDR48_DROYA WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 402 731 5.0E-11
sp|B4HRQ6|CIAO1_DROSE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 499 719 5.0E-11
sp|Q5BE22|PRP46_EMENI Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 405 724 5.0E-11
sp|B3MET8|WDR48_DROAN WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 402 731 5.0E-11
sp|Q0D0X6|LIS1_ASPTN Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 499 724 5.0E-11
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 419 686 6.0E-11
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 522 727 6.0E-11
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 499 720 6.0E-11
sp|Q6CMA2|CIAO1_KLULA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CIA1 PE=3 SV=1 529 747 6.0E-11
sp|B4MFM2|WDR48_DROVI WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 402 731 6.0E-11
sp|Q6L4F8|GBLPB_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 519 729 6.0E-11
sp|B3NSK1|WDR48_DROER WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 402 731 6.0E-11
sp|P17343|GBB1_CAEEL Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 419 720 6.0E-11
sp|Q61ZF6|GBB1_CAEBR Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 419 720 6.0E-11
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 45 306 7.0E-11
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 598 720 7.0E-11
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 499 722 7.0E-11
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 422 690 7.0E-11
sp|O74184|WAT1_SCHPO WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1 421 653 7.0E-11
sp|Q6CBI8|CIAO1_YARLI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 496 721 7.0E-11
sp|B4P7Q3|CIAO1_DROYA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 499 719 7.0E-11
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 393 720 7.0E-11
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 531 720 8.0E-11
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 598 720 8.0E-11
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 561 723 8.0E-11
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 66 243 9.0E-11
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 598 720 9.0E-11
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 499 724 9.0E-11
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 413 685 1.0E-10
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 595 720 1.0E-10
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 499 722 1.0E-10
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 598 720 1.0E-10
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 599 720 1.0E-10
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 598 720 1.0E-10
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 598 720 1.0E-10
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 534 722 1.0E-10
sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 419 720 1.0E-10
sp|P62880|GBB2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 419 720 1.0E-10
sp|P62879|GBB2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 419 720 1.0E-10
sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 419 720 1.0E-10
sp|Q9SJT9|COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 422 732 1.0E-10
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 65 306 1.0E-10
sp|O45040|GBB1_HOMAM Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 477 721 1.0E-10
sp|Q6DEY8|TBC31_XENTR TBC1 domain family member 31 OS=Xenopus tropicalis GN=tbc1d31 PE=2 SV=1 478 719 1.0E-10
sp|B4HND9|WDR48_DROSE WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 402 731 1.0E-10
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 537 720 1.0E-10
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 514 720 1.0E-10
sp|B4QB64|WDR48_DROSI WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 402 731 1.0E-10
sp|Q1LZ08|WDR48_DROME WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 402 731 1.0E-10
sp|Q6NNP0|ATG16_ARATH Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1 494 720 1.0E-10
sp|P93340|GBLP_NICPL Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 519 720 1.0E-10
sp|B4J8H6|WDR48_DROGR WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 402 731 1.0E-10
sp|Q20636|GBB2_CAEEL Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2 464 677 1.0E-10
sp|Q54TF6|LSM2_DICDI Probable U6 snRNA-associated Sm-like protein LSm2 OS=Dictyostelium discoideum GN=lsm2 PE=3 SV=1 945 996 1.0E-10
sp|Q6GMD2|WDR61_XENLA WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 419 678 2.0E-10
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 27 352 2.0E-10
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 595 720 2.0E-10
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 470 693 2.0E-10
sp|Q9Y6I7|WSB1_HUMAN WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 476 719 2.0E-10
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 76 266 2.0E-10
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 76 266 2.0E-10
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 598 722 2.0E-10
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 598 722 2.0E-10
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 463 681 2.0E-10
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 499 722 2.0E-10
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 475 727 2.0E-10
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 415 720 2.0E-10
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 380 710 2.0E-10
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 534 722 2.0E-10
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 466 727 2.0E-10
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 409 719 2.0E-10
sp|Q6CP71|PFS2_KLULA Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 360 677 2.0E-10
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 463 720 2.0E-10
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 426 719 2.0E-10
sp|B2AEZ5|LIS11_PODAN Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 499 724 2.0E-10
sp|Q54SF9|MHCKD_DICDI Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 417 725 2.0E-10
sp|O14435|GBB_CRYPA Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 419 719 2.0E-10
sp|P41318|LST8_YEAST Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 424 692 2.0E-10
sp|Q6TMK6|GBB1_CRIGR Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 475 720 2.0E-10
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 502 739 2.0E-10
sp|Q6FJ73|CIAO1_CANGA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIA1 PE=3 SV=1 496 744 2.0E-10
sp|P41811|COPB2_YEAST Coatomer subunit beta' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC27 PE=1 SV=1 437 718 2.0E-10
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 470 719 2.0E-10
sp|P49026|GBLP_TOBAC Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 519 720 2.0E-10
sp|P54311|GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 475 720 2.0E-10
sp|Q5R5W8|GBB1_PONAB Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 475 720 2.0E-10
sp|P62874|GBB1_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 475 720 2.0E-10
sp|P62873|GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 475 720 2.0E-10
sp|P62872|GBB1_CANLF Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 475 720 2.0E-10
sp|P62871|GBB1_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 475 720 2.0E-10
sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 480 722 2.0E-10
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 17 281 3.0E-10
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 549 720 3.0E-10
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 502 722 3.0E-10
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 598 720 3.0E-10
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 77 205 3.0E-10
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 547 722 3.0E-10
sp|Q9HAV0|GBB4_HUMAN Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 419 720 3.0E-10
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 417 681 3.0E-10
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 467 653 3.0E-10
sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 422 732 3.0E-10
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 496 726 3.0E-10
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 499 724 3.0E-10
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 419 686 4.0E-10
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 419 577 4.0E-10
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 392 679 4.0E-10
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 418 687 4.0E-10
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 510 720 4.0E-10
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 414 720 4.0E-10
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 562 722 4.0E-10
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 562 722 4.0E-10
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 562 722 4.0E-10
sp|O24076|GBLP_MEDSA Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 519 720 4.0E-10
sp|Q5VQ78|COB21_ORYSJ Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 437 714 4.0E-10
sp|Q28YY2|WDR48_DROPS WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 402 731 4.0E-10
sp|B4GIJ0|WDR48_DROPE WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 402 731 4.0E-10
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 463 720 4.0E-10
sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 520 689 4.0E-10
sp|Q5AG86|CIAO1_CANAL Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CIA1 PE=3 SV=1 496 737 4.0E-10
sp|O43071|PRP17_SCHPO Pre-mRNA-processing factor 17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp17 PE=1 SV=1 380 678 4.0E-10
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 516 735 5.0E-10
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 34 306 5.0E-10
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 68 302 5.0E-10
sp|Q6ZMY6|WDR88_HUMAN WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 377 685 5.0E-10
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 561 723 5.0E-10
sp|O45040|GBB1_HOMAM Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 419 720 5.0E-10
sp|P41318|LST8_YEAST Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 421 653 5.0E-10
sp|P54311|GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 419 720 5.0E-10
sp|P62874|GBB1_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 419 720 5.0E-10
sp|P62873|GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 419 720 5.0E-10
sp|P62872|GBB1_CANLF Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 419 720 5.0E-10
sp|P62871|GBB1_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 419 720 5.0E-10
sp|Q39836|GBLP_SOYBN Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 519 720 5.0E-10
sp|A3LVM1|CIAO1_PICST Probable cytosolic iron-sulfur protein assembly protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CIA1 PE=3 SV=2 495 719 5.0E-10
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 81 305 5.0E-10
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 463 714 5.0E-10
sp|P62882|GBB5_RAT Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 464 677 5.0E-10
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 401 719 6.0E-10
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 562 722 6.0E-10
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 562 722 6.0E-10
sp|Q5RDY7|GBB5_PONAB Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 464 677 6.0E-10
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 557 722 7.0E-10
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 557 722 7.0E-10
sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 499 728 7.0E-10
sp|P62880|GBB2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 499 728 7.0E-10
sp|P62879|GBB2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 499 728 7.0E-10
sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 499 728 7.0E-10
sp|A6ZYM0|CIAO1_YEAS7 Probable cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIA1 PE=3 SV=1 529 730 7.0E-10
sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 422 732 7.0E-10
sp|Q55FR9|COPA_DICDI Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 422 736 7.0E-10
sp|Q5SQM0|EMAL6_MOUSE Echinoderm microtubule-associated protein-like 6 OS=Mus musculus GN=Eml6 PE=2 SV=1 424 719 7.0E-10
sp|Q80ZD0|GBB5_TAMST Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 464 677 7.0E-10
sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 422 732 7.0E-10
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 590 720 8.0E-10
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 73 254 8.0E-10
sp|O54927|WSB1_MOUSE WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 476 719 8.0E-10
sp|Q86TI4|WDR86_HUMAN WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 419 726 8.0E-10
sp|Q5R5W8|GBB1_PONAB Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 419 720 8.0E-10
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 81 245 8.0E-10
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 519 720 8.0E-10
sp|Q05583|CIAO1_YEAST Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIA1 PE=1 SV=1 529 730 8.0E-10
sp|Q5GIS3|GBB_PINFU Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 419 720 8.0E-10
sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 87 244 8.0E-10
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 463 729 8.0E-10
sp|Q9LXN4|HIRA_ARATH Protein HIRA OS=Arabidopsis thaliana GN=HIRA PE=1 SV=2 503 715 8.0E-10
sp|Q7S7L4|LIS12_NEUCR Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 67 243 9.0E-10
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 66 241 9.0E-10
sp|Q94A40|COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 422 732 9.0E-10
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 499 724 9.0E-10
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 499 724 9.0E-10
sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 470 695 9.0E-10
sp|Q86HX1|HIRA_DICDI Protein HIRA OS=Dictyostelium discoideum GN=hira PE=3 SV=1 502 723 9.0E-10
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 594 720 9.0E-10
sp|P36408|GBB_DICDI Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 418 719 9.0E-10
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 42 244 1.0E-09
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 31 292 1.0E-09
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 77 216 1.0E-09
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 500 701 1.0E-09
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 419 655 1.0E-09
sp|D1ZEM6|LIS12_SORMK Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 67 243 1.0E-09
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 467 699 1.0E-09
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 499 688 1.0E-09
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 561 729 1.0E-09
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 573 729 1.0E-09
sp|P17343|GBB1_CAEEL Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 477 721 1.0E-09
sp|Q61ZF6|GBB1_CAEBR Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 477 721 1.0E-09
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 443 629 1.0E-09
sp|Q6TMK6|GBB1_CRIGR Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 419 720 1.0E-09
sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 469 722 1.0E-09
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 499 724 1.0E-09
sp|O15736|TIPD_DICDI Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1 502 718 1.0E-09
sp|Q6PNB6|GBB5_RABIT Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 464 677 1.0E-09
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 81 244 1.0E-09
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 81 244 1.0E-09
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 81 244 1.0E-09
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 81 244 1.0E-09
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 81 244 1.0E-09
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 81 244 1.0E-09
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 81 244 1.0E-09
sp|B8M0Q1|LIS1_TALSN Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 569 720 1.0E-09
sp|B8M0Q1|LIS1_TALSN Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 437 693 1.0E-09
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 81 305 1.0E-09
sp|P62881|GBB5_MOUSE Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 468 677 1.0E-09
sp|Q00659|SCONB_EMENI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 450 720 1.0E-09
sp|B6QC56|LIS11_TALMQ Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 567 720 1.0E-09
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 496 721 1.0E-09
sp|P42841|PFS2_YEAST Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 470 678 1.0E-09
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 496 721 1.0E-09
sp|O14775|GBB5_HUMAN Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 468 677 1.0E-09
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 73 241 2.0E-09
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 67 243 2.0E-09
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 536 740 2.0E-09
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 536 720 2.0E-09
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 536 720 2.0E-09
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 80 241 2.0E-09
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 561 719 2.0E-09
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 419 630 2.0E-09
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 419 630 2.0E-09
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 66 241 2.0E-09
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 499 758 2.0E-09
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 500 719 2.0E-09
sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 469 722 2.0E-09
sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 469 722 2.0E-09
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 399 720 2.0E-09
sp|Q8C7V3|UTP15_MOUSE U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1 439 701 2.0E-09
sp|Q9FUY2|LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana GN=LUG PE=1 SV=2 497 719 2.0E-09
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 500 721 2.0E-09
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 450 655 2.0E-09
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 500 721 2.0E-09
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 598 727 2.0E-09
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 450 655 2.0E-09
sp|P26308|GBB1_DROME Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 463 720 2.0E-09
sp|C5FP68|SCONB_ARTOC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 411 720 2.0E-09
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 474 758 2.0E-09
sp|O48847|LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 455 720 2.0E-09
sp|Q39336|GBLP_BRANA Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 601 739 2.0E-09
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 466 720 2.0E-09
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 399 720 2.0E-09
sp|Q08706|GBB_LYMST Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 419 720 2.0E-09
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 572 731 2.0E-09
sp|Q8W117|SMU1_ARATH Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 568 720 2.0E-09
sp|Q5DFU0|CIAO1_SCHJA Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 497 719 2.0E-09
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 87 241 3.0E-09
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 561 729 3.0E-09
sp|D1ZEM6|LIS12_SORMK Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 548 720 3.0E-09
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 87 244 3.0E-09
sp|Q6PH57|GBB1_DANRE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 415 630 3.0E-09
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 475 685 3.0E-09
sp|Q5RDY7|GBB5_PONAB Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 380 631 3.0E-09
sp|Q80ZD0|GBB5_TAMST Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 380 631 3.0E-09
sp|Q6PNB6|GBB5_RABIT Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 380 631 3.0E-09
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 519 720 3.0E-09
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 601 739 3.0E-09
sp|A2RRU3|UTP15_RAT U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1 439 701 3.0E-09
sp|Q8TED0|UTP15_HUMAN U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens GN=UTP15 PE=1 SV=3 439 701 3.0E-09
sp|O35353|GBB4_RAT Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4 475 720 3.0E-09
sp|P29387|GBB4_MOUSE Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4 475 720 3.0E-09
sp|Q9BRX9|WDR83_HUMAN WD repeat domain-containing protein 83 OS=Homo sapiens GN=WDR83 PE=1 SV=1 426 717 3.0E-09
sp|O94967|WDR47_HUMAN WD repeat-containing protein 47 OS=Homo sapiens GN=WDR47 PE=1 SV=1 352 677 3.0E-09
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 590 727 4.0E-09
sp|Q7S7L4|LIS12_NEUCR Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 548 720 4.0E-09
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 531 724 4.0E-09
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 531 727 4.0E-09
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 396 588 4.0E-09
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 419 729 4.0E-09
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 542 752 4.0E-09
sp|B6GZD3|LIS12_PENRW Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 562 725 4.0E-09
sp|P79959|GBB1_XENLA Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 419 720 4.0E-09
sp|Q6CP71|PFS2_KLULA Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 469 678 4.0E-09
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 480 722 4.0E-09
sp|P26308|GBB1_DROME Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 477 720 4.0E-09
sp|P26308|GBB1_DROME Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 415 630 4.0E-09
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 415 720 4.0E-09
sp|Q922B6|TRAF7_MOUSE E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 468 719 4.0E-09
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 567 722 4.0E-09
sp|P0CS38|HIR1_CRYNJ Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HIR1 PE=3 SV=1 506 753 4.0E-09
sp|P0CS39|HIR1_CRYNB Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HIR1 PE=3 SV=1 506 753 4.0E-09
sp|Q04726|TLE3_HUMAN Transducin-like enhancer protein 3 OS=Homo sapiens GN=TLE3 PE=1 SV=2 352 635 4.0E-09
sp|Q6ZMW3|EMAL6_HUMAN Echinoderm microtubule-associated protein-like 6 OS=Homo sapiens GN=EML6 PE=2 SV=2 370 719 4.0E-09
sp|P39014|MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 475 748 4.0E-09
sp|Q08122|TLE3_MOUSE Transducin-like enhancer protein 3 OS=Mus musculus GN=Tle3 PE=1 SV=3 352 635 4.0E-09
sp|P25635|PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 467 753 4.0E-09
sp|Q9JIT3|TLE3_RAT Transducin-like enhancer protein 3 OS=Rattus norvegicus GN=Tle3 PE=1 SV=1 352 635 4.0E-09
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 419 686 5.0E-09
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 84 243 5.0E-09
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 81 241 5.0E-09
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 84 243 5.0E-09
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 531 727 5.0E-09
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 407 679 5.0E-09
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 569 720 5.0E-09
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 77 199 5.0E-09
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 495 722 5.0E-09
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 499 728 5.0E-09
sp|A0AUS0|WSDU1_DANRE WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 410 686 5.0E-09
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 81 243 5.0E-09
sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 496 739 5.0E-09
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 561 720 5.0E-09
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 561 720 5.0E-09
sp|O42469|TLE1_XENLA Transducin-like enhancer protein 1 OS=Xenopus laevis GN=esg1 PE=2 SV=1 395 635 5.0E-09
sp|P42527|MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 10 245 5.0E-09
sp|B9WHJ2|CIAO1_CANDC Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CIA1 PE=3 SV=1 496 736 5.0E-09
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 387 720 5.0E-09
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 575 720 5.0E-09
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 28 243 6.0E-09
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 518 719 6.0E-09
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 564 729 6.0E-09
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 84 243 6.0E-09
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 77 199 6.0E-09
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 419 677 6.0E-09
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 80 251 6.0E-09
sp|Q0D0X6|LIS1_ASPTN Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 103 243 6.0E-09
sp|P62882|GBB5_RAT Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 380 631 6.0E-09
sp|B6QC56|LIS11_TALMQ Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 499 678 6.0E-09
sp|O14775|GBB5_HUMAN Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 380 631 6.0E-09
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 617 727 6.0E-09
sp|Q6Q0C0|TRAF7_HUMAN E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1 468 719 6.0E-09
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 466 720 6.0E-09
sp|P23232|GBB_LOLFO Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 415 630 6.0E-09
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 87 241 7.0E-09
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 550 720 7.0E-09
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 87 241 7.0E-09
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 87 241 7.0E-09
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 87 241 7.0E-09
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 87 241 7.0E-09
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 87 241 7.0E-09
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 87 241 7.0E-09
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 87 241 7.0E-09
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 87 241 7.0E-09
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 591 731 7.0E-09
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 443 629 7.0E-09
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 617 727 7.0E-09
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 617 727 7.0E-09
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 617 727 7.0E-09
sp|C5FP68|SCONB_ARTOC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 450 655 7.0E-09
sp|Q5XGI5|WDR83_XENTR WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 405 710 7.0E-09
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 463 720 7.0E-09
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 597 720 8.0E-09
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 500 732 8.0E-09
sp|P42527|MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 419 720 8.0E-09
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 504 722 8.0E-09
sp|O13166|TLE2_DANRE Protein groucho-2 OS=Danio rerio GN=gro2 PE=1 SV=1 370 635 8.0E-09
sp|Q4P5F5|CIAO1_USTMA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CIA1 PE=3 SV=1 491 723 8.0E-09
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 414 722 9.0E-09
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 87 241 9.0E-09
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 433 677 9.0E-09
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 443 629 9.0E-09
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 411 720 9.0E-09
sp|Q4I7X1|PFS2_GIBZE Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 470 711 9.0E-09
sp|Q7RY68|PFS2_NEUCR Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 470 711 9.0E-09
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 564 720 9.0E-09
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 68 254 1.0E-08
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 104 305 1.0E-08
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 87 243 1.0E-08
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 68 302 1.0E-08
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 68 302 1.0E-08
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 419 655 1.0E-08
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 87 241 1.0E-08
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 515 720 1.0E-08
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 80 302 1.0E-08
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 515 720 1.0E-08
sp|Q4ICM0|LIS1_GIBZE Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 81 245 1.0E-08
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 599 720 1.0E-08
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 599 720 1.0E-08
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 599 720 1.0E-08
sp|B4J8H6|WDR48_DROGR WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 419 636 1.0E-08
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 28 297 1.0E-08
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 28 297 1.0E-08
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 49 137 1.0E-08
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 480 719 1.0E-08
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 28 285 1.0E-08
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 500 732 1.0E-08
sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 436 822 1.0E-08
sp|P62881|GBB5_MOUSE Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 380 631 1.0E-08
sp|Q6FJS0|PFS2_CANGA Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 472 678 1.0E-08
sp|Q9NWT1|PK1IP_HUMAN p21-activated protein kinase-interacting protein 1 OS=Homo sapiens GN=PAK1IP1 PE=1 SV=2 611 719 1.0E-08
sp|A8QB65|WDR12_BRUMA Ribosome biogenesis protein WDR12 homolog OS=Brugia malayi GN=Bm1_47965 PE=3 SV=1 430 719 1.0E-08
sp|Q62440|TLE1_MOUSE Transducin-like enhancer protein 1 OS=Mus musculus GN=Tle1 PE=1 SV=2 363 635 1.0E-08
sp|Q75C26|CIAO1_ASHGO Probable cytosolic iron-sulfur protein assembly protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CIA1 PE=3 SV=1 536 719 1.0E-08
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 49 137 1.0E-08
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 49 137 1.0E-08
sp|P29829|GBB2_DROME Guanine nucleotide-binding protein subunit beta-2 OS=Drosophila melanogaster GN=Gbeta76C PE=1 SV=3 500 735 1.0E-08
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 49 137 1.0E-08
sp|A7MB12|UTP15_BOVIN U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1 439 701 1.0E-08
sp|Q75BY3|PRP46_ASHGO Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 68 243 1.0E-08
sp|Q20168|COPB2_CAEEL Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3 437 719 1.0E-08
sp|Q5AXW3|MDV1_EMENI Mitochondrial division protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdv1 PE=3 SV=2 437 692 1.0E-08
sp|Q8CGF6|WDR47_MOUSE WD repeat-containing protein 47 OS=Mus musculus GN=Wdr47 PE=1 SV=2 354 677 1.0E-08
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 49 137 1.0E-08
sp|Q00664|LIS1_EMENI Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 81 243 1.0E-08
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 476 677 1.0E-08
sp|O42478|TLE4_XENLA Transducin-like enhancer protein 4 OS=Xenopus laevis GN=tle4 PE=1 SV=2 395 635 1.0E-08
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 575 758 1.0E-08
sp|Q04727|TLE4_HUMAN Transducin-like enhancer protein 4 OS=Homo sapiens GN=TLE4 PE=1 SV=3 395 635 1.0E-08
sp|Q8N9V3|WSDU1_HUMAN WD repeat, SAM and U-box domain-containing protein 1 OS=Homo sapiens GN=WDSUB1 PE=1 SV=3 410 680 1.0E-08
sp|Q62441|TLE4_MOUSE Transducin-like enhancer protein 4 OS=Mus musculus GN=Tle4 PE=1 SV=4 395 635 1.0E-08
sp|P97499|TEP1_MOUSE Telomerase protein component 1 OS=Mus musculus GN=Tep1 PE=1 SV=1 429 720 1.0E-08
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 77 294 2.0E-08
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 104 305 2.0E-08
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 562 719 2.0E-08
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 77 243 2.0E-08
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 77 243 2.0E-08
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 35 255 2.0E-08
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 78 254 2.0E-08
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 415 679 2.0E-08
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 87 241 2.0E-08
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 87 241 2.0E-08
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 73 241 2.0E-08
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 407 660 2.0E-08
sp|Q61011|GBB3_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 415 630 2.0E-08
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 466 720 2.0E-08
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 569 720 2.0E-08
sp|P74598|Y1491_SYNY3 Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 426 534 2.0E-08
sp|P53699|CDC4_CANAX Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1 419 719 2.0E-08
sp|B4HND9|WDR48_DROSE WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 419 636 2.0E-08
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 407 630 2.0E-08
sp|B4QB64|WDR48_DROSI WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 419 636 2.0E-08
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 499 767 2.0E-08
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 499 767 2.0E-08
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 500 732 2.0E-08
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 28 285 2.0E-08
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 480 720 2.0E-08
sp|P42841|PFS2_YEAST Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 551 720 2.0E-08
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 411 720 2.0E-08
sp|Q6Q0C0|TRAF7_HUMAN E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1 419 719 2.0E-08
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 77 242 2.0E-08
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 575 758 2.0E-08
sp|Q40507|GBB3_TOBAC Guanine nucleotide-binding protein subunit beta OS=Nicotiana tabacum PE=2 SV=1 419 719 2.0E-08
sp|Q9UT57|CFD1_SCHPO Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.02c PE=3 SV=1 487 719 2.0E-08
sp|Q6BVZ3|PFS2_DEBHA Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 549 720 2.0E-08
sp|Q04724|TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens GN=TLE1 PE=1 SV=2 370 635 2.0E-08
sp|Q9XW12|CIAO1_CAEEL Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Caenorhabditis elegans GN=Y18D10A.9 PE=1 SV=2 507 718 2.0E-08
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 48 253 3.0E-08
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 68 254 3.0E-08
sp|Q9W5Z5|WSB1_TAKRU WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 476 720 3.0E-08
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 28 241 3.0E-08
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 28 241 3.0E-08
sp|Q05946|UTP13_YEAST U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 600 722 3.0E-08
sp|P52287|GBB3_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 415 630 3.0E-08
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 593 727 3.0E-08
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 468 681 3.0E-08
sp|B4KRQ4|WDR48_DROMO WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 419 636 3.0E-08
sp|B4MFM2|WDR48_DROVI WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 419 636 3.0E-08
sp|Q5GIS3|GBB_PINFU Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 499 726 3.0E-08
sp|Q08706|GBB_LYMST Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 499 720 3.0E-08
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 480 688 3.0E-08
sp|Q922B6|TRAF7_MOUSE E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 419 719 3.0E-08
sp|P39014|MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 562 720 3.0E-08
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 476 677 3.0E-08
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 499 722 4.0E-08
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 103 305 4.0E-08
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 104 305 4.0E-08
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 78 296 4.0E-08
sp|Q7PS24|CIAO1_ANOGA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 593 720 4.0E-08
sp|Q9HAV0|GBB4_HUMAN Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 415 630 4.0E-08
sp|Q9C270|PWP2_NEUCR Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 467 719 4.0E-08
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 87 245 4.0E-08
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 87 245 4.0E-08
sp|Q5GIS3|GBB_PINFU Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 415 630 4.0E-08
sp|O35353|GBB4_RAT Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4 419 720 4.0E-08
sp|P23232|GBB_LOLFO Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 477 732 4.0E-08
sp|Q00664|LIS1_EMENI Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 499 724 4.0E-08
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 77 242 4.0E-08
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 65 279 5.0E-08
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 65 279 5.0E-08
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 419 636 5.0E-08
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 28 241 5.0E-08
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 81 245 5.0E-08
sp|B3MET8|WDR48_DROAN WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 419 636 5.0E-08
sp|Q20636|GBB2_CAEEL Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2 380 631 5.0E-08
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 476 677 5.0E-08
sp|Q08706|GBB_LYMST Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 415 630 5.0E-08
sp|P23232|GBB_LOLFO Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 419 720 5.0E-08
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 103 306 6.0E-08
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 415 655 6.0E-08
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 562 722 6.0E-08
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 415 655 6.0E-08
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 562 722 6.0E-08
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 515 720 6.0E-08
sp|Q9I9H8|APAF_DANRE Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1 417 681 6.0E-08
sp|Q20636|GBB2_CAEEL Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2 500 731 6.0E-08
sp|Q28YY2|WDR48_DROPS WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 419 636 6.0E-08
sp|B4GIJ0|WDR48_DROPE WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 419 636 6.0E-08
sp|Q5SQM0|EMAL6_MOUSE Echinoderm microtubule-associated protein-like 6 OS=Mus musculus GN=Eml6 PE=2 SV=1 434 683 6.0E-08
sp|P29387|GBB4_MOUSE Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4 419 720 6.0E-08
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 59 212 6.0E-08
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 38 306 7.0E-08
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 103 305 7.0E-08
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 81 319 7.0E-08
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 87 243 7.0E-08
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 87 241 7.0E-08
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 87 241 7.0E-08
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 87 241 7.0E-08
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 419 636 7.0E-08
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 419 720 7.0E-08
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 67 243 7.0E-08
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 602 725 7.0E-08
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 76 310 7.0E-08
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 480 720 7.0E-08
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 480 720 7.0E-08
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 480 720 7.0E-08
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 480 720 7.0E-08
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 480 720 7.0E-08
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 480 720 7.0E-08
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 480 720 7.0E-08
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 87 241 8.0E-08
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 87 241 8.0E-08
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 87 241 8.0E-08
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 66 243 8.0E-08
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 599 720 8.0E-08
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 477 747 9.0E-08
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 67 243 9.0E-08
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 67 243 9.0E-08
sp|Q55FR9|COPA_DICDI Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 88 307 9.0E-08
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 28 199 1.0E-07
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 103 306 1.0E-07
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 477 747 1.0E-07
sp|C7Z6H2|LIS1_NECH7 Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 67 246 1.0E-07
sp|P38011|GBLP_YEAST Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 454 720 1.0E-07
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 419 720 1.0E-07
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 87 244 1.0E-07
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 87 244 1.0E-07
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 419 720 1.0E-07
sp|P16520|GBB3_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 415 630 1.0E-07
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 80 244 1.0E-07
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 599 724 1.0E-07
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 599 720 1.0E-07
sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 415 630 1.0E-07
sp|P62880|GBB2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 415 630 1.0E-07
sp|P62879|GBB2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 415 630 1.0E-07
sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 415 630 1.0E-07
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 500 691 1.0E-07
sp|P79959|GBB1_XENLA Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 415 630 1.0E-07
sp|B4P7H8|WDR48_DROYA WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 419 636 1.0E-07
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 76 244 1.0E-07
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 599 720 1.0E-07
sp|O43071|PRP17_SCHPO Pre-mRNA-processing factor 17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp17 PE=1 SV=1 564 720 1.0E-07
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 500 702 1.0E-07
sp|B8M0Q1|LIS1_TALSN Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 499 678 1.0E-07
sp|P26308|GBB1_DROME Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 499 728 1.0E-07
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 77 242 1.0E-07
sp|P25635|PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 422 599 1.0E-07
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 419 634 1.0E-07
sp|P29829|GBB2_DROME Guanine nucleotide-binding protein subunit beta-2 OS=Drosophila melanogaster GN=Gbeta76C PE=1 SV=3 386 719 1.0E-07
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 34 241 2.0E-07
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 76 306 2.0E-07
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 477 747 2.0E-07
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 21 321 2.0E-07
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 27 241 2.0E-07
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 66 241 2.0E-07
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 66 241 2.0E-07
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 48 241 2.0E-07
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 87 321 2.0E-07
sp|Q7T2F6|WSB1_DANRE WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 476 719 2.0E-07
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 87 241 2.0E-07
sp|Q05946|UTP13_YEAST U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 415 590 2.0E-07
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 87 243 2.0E-07
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 40 241 2.0E-07
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 419 720 2.0E-07
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 593 720 2.0E-07
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 419 636 2.0E-07
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 419 636 2.0E-07
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 67 243 2.0E-07
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 414 719 2.0E-07
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 602 725 2.0E-07
sp|P79147|GBB3_CANLF Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 415 630 2.0E-07
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 499 757 2.0E-07
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 564 723 2.0E-07
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 80 250 2.0E-07
sp|P69104|GBLP_TRYBR Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 81 301 2.0E-07
sp|P69103|GBLP_TRYBB Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 81 301 2.0E-07
sp|B3NSK1|WDR48_DROER WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 419 636 2.0E-07
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 77 207 2.0E-07
sp|Q1LZ08|WDR48_DROME WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 419 636 2.0E-07
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 466 720 2.0E-07
sp|O24076|GBLP_MEDSA Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 81 311 2.0E-07
sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 564 727 2.0E-07
sp|Q5RDY7|GBB5_PONAB Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 466 719 2.0E-07
sp|Q80ZD0|GBB5_TAMST Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 466 719 2.0E-07
sp|Q6PNB6|GBB5_RABIT Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 466 719 2.0E-07
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 81 328 2.0E-07
sp|P25635|PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 407 635 2.0E-07
sp|Q00664|LIS1_EMENI Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 562 725 2.0E-07
sp|Q6BVZ3|PFS2_DEBHA Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 470 691 2.0E-07
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 77 243 3.0E-07
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 76 241 3.0E-07
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 76 241 3.0E-07
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 76 241 3.0E-07
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 76 241 3.0E-07
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 22 302 3.0E-07
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 76 241 3.0E-07
sp|Q6P1V3|WSB1_XENTR WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 476 720 3.0E-07
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 59 244 3.0E-07
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 103 305 3.0E-07
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 87 241 3.0E-07
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 80 306 3.0E-07
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 515 720 3.0E-07
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 87 241 3.0E-07
sp|P83774|GBLP_CANAL Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 87 244 3.0E-07
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 73 216 3.0E-07
sp|Q86TI4|WDR86_HUMAN WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 421 687 3.0E-07
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 419 678 3.0E-07
sp|O45040|GBB1_HOMAM Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 415 630 3.0E-07
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 589 737 3.0E-07
sp|Q6TMK6|GBB1_CRIGR Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 415 630 3.0E-07
sp|P54311|GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 415 630 3.0E-07
sp|Q5R5W8|GBB1_PONAB Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 415 630 3.0E-07
sp|P62874|GBB1_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 415 630 3.0E-07
sp|P62873|GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 415 630 3.0E-07
sp|P62872|GBB1_CANLF Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 415 630 3.0E-07
sp|P62871|GBB1_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 415 630 3.0E-07
sp|P62882|GBB5_RAT Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 466 719 3.0E-07
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 81 311 3.0E-07
sp|O14775|GBB5_HUMAN Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 466 719 3.0E-07
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 599 725 3.0E-07
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 34 208 4.0E-07
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 1 202 4.0E-07
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 593 727 4.0E-07
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 13 285 4.0E-07
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 87 243 4.0E-07
sp|Q9Z2K5|LST8_RAT Target of rapamycin complex subunit LST8 OS=Rattus norvegicus GN=Mlst8 PE=1 SV=2 431 719 4.0E-07
sp|Q6L4F8|GBLPB_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 81 306 4.0E-07
sp|P17343|GBB1_CAEEL Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 415 630 4.0E-07
sp|Q61ZF6|GBB1_CAEBR Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 415 630 4.0E-07
sp|Q28YY2|WDR48_DROPS WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 16 240 4.0E-07
sp|B4GIJ0|WDR48_DROPE WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 16 240 4.0E-07
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 480 720 4.0E-07
sp|Q00659|SCONB_EMENI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 59 212 4.0E-07
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 422 720 4.0E-07
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 419 703 4.0E-07
sp|Q6FJS0|PFS2_CANGA Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 551 725 4.0E-07
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 34 241 5.0E-07
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 22 254 5.0E-07
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 81 303 5.0E-07
sp|P16520|GBB3_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 499 725 5.0E-07
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 500 679 5.0E-07
sp|O62621|COPB2_DROME Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 87 241 5.0E-07
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 81 241 5.0E-07
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 598 720 5.0E-07
sp|Q9BVC4|LST8_HUMAN Target of rapamycin complex subunit LST8 OS=Homo sapiens GN=MLST8 PE=1 SV=1 431 719 5.0E-07
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 42 199 5.0E-07
sp|C4JZS6|LIS11_UNCRE Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 81 314 5.0E-07
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 564 720 5.0E-07
sp|B4P7H8|WDR48_DROYA WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 16 240 5.0E-07
sp|Q1LZ08|WDR48_DROME WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 16 240 5.0E-07
sp|Q6CP71|PFS2_KLULA Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 551 720 5.0E-07
sp|P49026|GBLP_TOBAC Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 428 719 5.0E-07
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 599 726 5.0E-07
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 599 726 5.0E-07
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 599 726 5.0E-07
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 599 726 5.0E-07
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 599 726 5.0E-07
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 599 726 5.0E-07
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 599 726 5.0E-07
sp|P62881|GBB5_MOUSE Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 466 719 5.0E-07
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 59 212 5.0E-07
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 20 254 6.0E-07
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 20 254 6.0E-07
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 20 254 6.0E-07
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 20 254 6.0E-07
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 21 253 6.0E-07
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 87 241 6.0E-07
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 87 243 6.0E-07
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 48 248 6.0E-07
sp|Q61011|GBB3_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 499 733 6.0E-07
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 561 735 6.0E-07
sp|Q17QU5|LST8_BOVIN Target of rapamycin complex subunit LST8 OS=Bos taurus GN=MLST8 PE=2 SV=1 431 719 6.0E-07
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 500 691 6.0E-07
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 534 719 6.0E-07
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 561 720 6.0E-07
sp|P93340|GBLP_NICPL Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 80 330 6.0E-07
sp|P49026|GBLP_TOBAC Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 80 330 6.0E-07
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 599 726 6.0E-07
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 79 202 7.0E-07
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 103 243 7.0E-07
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 67 243 7.0E-07
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 35 250 7.0E-07
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 87 241 7.0E-07
sp|B3MC74|CIAO1_DROAN Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 593 727 7.0E-07
sp|P79147|GBB3_CANLF Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 499 725 7.0E-07
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 42 259 7.0E-07
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 594 727 7.0E-07
sp|B3MET8|WDR48_DROAN WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 16 240 7.0E-07
sp|B3NSK1|WDR48_DROER WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 16 240 7.0E-07
sp|Q39836|GBLP_SOYBN Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 480 688 7.0E-07
sp|Q5SQM0|EMAL6_MOUSE Echinoderm microtubule-associated protein-like 6 OS=Mus musculus GN=Eml6 PE=2 SV=1 344 579 7.0E-07
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 45 320 7.0E-07
sp|P23232|GBB_LOLFO Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 499 726 7.0E-07
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 87 244 8.0E-07
sp|P52287|GBB3_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 499 725 8.0E-07
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 466 720 8.0E-07
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 561 720 8.0E-07
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 42 259 8.0E-07
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 513 720 8.0E-07
sp|Q39336|GBLP_BRANA Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 480 688 8.0E-07
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 80 306 9.0E-07
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 67 243 9.0E-07
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 87 241 9.0E-07
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 87 268 9.0E-07
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 534 719 9.0E-07
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 534 719 9.0E-07
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 534 719 9.0E-07
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 534 719 9.0E-07
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 534 719 9.0E-07
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 534 719 9.0E-07
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 477 722 9.0E-07
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 34 306 1.0E-06
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 419 580 1.0E-06
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 419 580 1.0E-06
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 87 243 1.0E-06
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 20 254 1.0E-06
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 68 254 1.0E-06
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 67 243 1.0E-06
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 437 653 1.0E-06
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 437 653 1.0E-06
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 419 653 1.0E-06
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 87 243 1.0E-06
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 68 279 1.0E-06
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 585 720 1.0E-06
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 81 243 1.0E-06
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 564 719 1.0E-06
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 564 719 1.0E-06
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 410 585 1.0E-06
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 81 243 1.0E-06
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 404 678 1.0E-06
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 67 243 1.0E-06
sp|B4KRQ4|WDR48_DROMO WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 16 240 1.0E-06
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 42 199 1.0E-06
sp|B4HRQ6|CIAO1_DROSE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 593 727 1.0E-06
sp|Q0D0X6|LIS1_ASPTN Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 562 725 1.0E-06
sp|B4HND9|WDR48_DROSE WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 16 240 1.0E-06
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 457 751 1.0E-06
sp|B4QB64|WDR48_DROSI WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 16 240 1.0E-06
sp|P93340|GBLP_NICPL Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 480 678 1.0E-06
sp|B4J8H6|WDR48_DROGR WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 16 240 1.0E-06
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 561 720 1.0E-06
sp|O14435|GBB_CRYPA Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 418 631 1.0E-06
sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 81 244 1.0E-06
sp|Q5VQ78|COB21_ORYSJ Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 472 719 1.0E-06
sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 422 590 1.0E-06
sp|Q39836|GBLP_SOYBN Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 81 311 1.0E-06
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 495 699 1.0E-06
sp|Q6ZMW3|EMAL6_HUMAN Echinoderm microtubule-associated protein-like 6 OS=Homo sapiens GN=EML6 PE=2 SV=2 434 632 1.0E-06
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 48 247 1.0E-06
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 416 678 1.0E-06
sp|Q6FJS0|PFS2_CANGA Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 419 677 1.0E-06
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 80 318 2.0E-06
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 494 720 2.0E-06
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 27 259 2.0E-06
sp|Q6PBD6|WDR61_XENTR WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 494 720 2.0E-06
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 27 259 2.0E-06
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 22 254 2.0E-06
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 419 580 2.0E-06
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 68 279 2.0E-06
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 87 241 2.0E-06
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 22 254 2.0E-06
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 67 241 2.0E-06
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 33 320 2.0E-06
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 87 244 2.0E-06
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 30 243 2.0E-06
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 80 304 2.0E-06
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 80 241 2.0E-06
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 87 243 2.0E-06
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 585 720 2.0E-06
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 80 241 2.0E-06
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 80 241 2.0E-06
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 48 247 2.0E-06
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 48 247 2.0E-06
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 68 241 2.0E-06
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 81 241 2.0E-06
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 77 241 2.0E-06
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 622 725 2.0E-06
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 594 720 2.0E-06
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 67 241 2.0E-06
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 67 241 2.0E-06
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 103 280 2.0E-06
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 594 720 2.0E-06
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 594 720 2.0E-06
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 87 268 2.0E-06
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 79 208 2.0E-06
sp|B3NQR5|CIAO1_DROER Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 593 727 2.0E-06
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 534 719 2.0E-06
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 594 720 2.0E-06
sp|B4QFZ8|CIAO1_DROSI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 593 727 2.0E-06
sp|Q7K1Y4|CIAO1_DROME Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 593 727 2.0E-06
sp|B4MFM2|WDR48_DROVI WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 16 240 2.0E-06
sp|Q6L4F8|GBLPB_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 419 630 2.0E-06
sp|Q6CBI8|CIAO1_YARLI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 561 724 2.0E-06
sp|B4P7Q3|CIAO1_DROYA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 593 727 2.0E-06
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 475 719 2.0E-06
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 500 679 2.0E-06
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 472 720 2.0E-06
sp|Q55FR9|COPA_DICDI Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 564 722 2.0E-06
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 564 719 2.0E-06
sp|O15736|TIPD_DICDI Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1 601 720 2.0E-06
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 495 720 2.0E-06
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 495 720 2.0E-06
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 495 720 2.0E-06
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 495 720 2.0E-06
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 495 720 2.0E-06
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 495 720 2.0E-06
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 495 720 2.0E-06
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 499 720 2.0E-06
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 494 724 2.0E-06
sp|Q39336|GBLP_BRANA Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 81 311 2.0E-06
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 484 724 2.0E-06
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 81 311 2.0E-06
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 464 720 2.0E-06
sp|Q75BY3|PRP46_ASHGO Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 463 751 2.0E-06
sp|Q75BY3|PRP46_ASHGO Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 492 733 2.0E-06
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 606 723 3.0E-06
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 602 728 3.0E-06
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 420 719 3.0E-06
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 419 680 3.0E-06
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 80 243 3.0E-06
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 87 241 3.0E-06
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 87 241 3.0E-06
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 87 241 3.0E-06
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 87 241 3.0E-06
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 87 241 3.0E-06
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 87 241 3.0E-06
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 87 241 3.0E-06
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 103 244 3.0E-06
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 87 241 3.0E-06
sp|P38011|GBLP_YEAST Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 591 719 3.0E-06
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 68 254 3.0E-06
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 68 254 3.0E-06
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 68 254 3.0E-06
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 48 247 3.0E-06
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 81 208 3.0E-06
sp|Q292E8|CIAO1_DROPS Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 593 727 3.0E-06
sp|B4GDM7|CIAO1_DROPE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 593 727 3.0E-06
sp|Q9DCJ1|LST8_MOUSE Target of rapamycin complex subunit LST8 OS=Mus musculus GN=Mlst8 PE=1 SV=1 431 719 3.0E-06
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 42 260 3.0E-06
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 503 727 3.0E-06
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 34 162 3.0E-06
sp|Q8L828|COB23_ARATH Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 472 719 3.0E-06
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 104 243 3.0E-06
sp|O74184|WAT1_SCHPO WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1 424 692 3.0E-06
sp|O24076|GBLP_MEDSA Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 428 688 3.0E-06
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 101 281 3.0E-06
sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 599 769 3.0E-06
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 101 281 3.0E-06
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 101 255 3.0E-06
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 101 255 3.0E-06
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 480 688 3.0E-06
sp|P42527|MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 470 723 3.0E-06
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 507 720 3.0E-06
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 507 720 3.0E-06
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 507 720 3.0E-06
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 76 241 4.0E-06
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 87 241 4.0E-06
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 79 207 4.0E-06
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 67 243 4.0E-06
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 77 241 4.0E-06
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 87 241 4.0E-06
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 87 241 4.0E-06
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 87 241 4.0E-06
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 420 534 4.0E-06
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 77 202 4.0E-06
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 101 281 4.0E-06
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 40 257 4.0E-06
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 576 727 5.0E-06
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 77 304 5.0E-06
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 413 630 5.0E-06
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 599 720 5.0E-06
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 77 241 5.0E-06
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 77 241 5.0E-06
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 87 241 5.0E-06
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 77 241 5.0E-06
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 87 241 5.0E-06
sp|Q05946|UTP13_YEAST U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 80 241 5.0E-06
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 13 243 5.0E-06
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 103 244 5.0E-06
sp|Q5BE22|PRP46_EMENI Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 96 243 5.0E-06
sp|Q6CMA2|CIAO1_KLULA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CIA1 PE=3 SV=1 476 749 5.0E-06
sp|Q6CMA2|CIAO1_KLULA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CIA1 PE=3 SV=1 87 244 5.0E-06
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 101 281 5.0E-06
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 507 720 5.0E-06
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 87 241 6.0E-06
sp|O55029|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 87 241 6.0E-06
sp|O35142|COPB2_RAT Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 87 241 6.0E-06
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 87 243 6.0E-06
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 96 243 6.0E-06
sp|B4LJT7|CIAO1_DROVI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 593 727 6.0E-06
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 567 736 6.0E-06
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 614 737 6.0E-06
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 592 743 7.0E-06
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 592 720 7.0E-06
sp|Q5ZJH5|WDR61_CHICK WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 501 720 7.0E-06
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 48 198 7.0E-06
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 66 311 7.0E-06
sp|P35605|COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 87 241 7.0E-06
sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 87 241 7.0E-06
sp|Q5R664|COPB2_PONAB Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 87 241 7.0E-06
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 593 727 7.0E-06
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 103 281 7.0E-06
sp|O14435|GBB_CRYPA Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 36 242 7.0E-06
sp|Q9FUY2|LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana GN=LUG PE=1 SV=2 47 304 7.0E-06
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 104 255 7.0E-06
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 84 258 8.0E-06
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 87 323 8.0E-06
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 77 198 8.0E-06
sp|Q4R4I8|COPB2_MACFA Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 87 241 8.0E-06
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 533 720 8.0E-06
sp|B4MY77|CIAO1_DROWI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 593 727 8.0E-06
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 81 214 8.0E-06
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 77 254 8.0E-06
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 87 241 9.0E-06
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 68 246 9.0E-06
sp|P93340|GBLP_NICPL Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 614 731 9.0E-06
sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 71 339 9.0E-06
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 59 254 9.0E-06
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 500 678 1.0E-05
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 368 541 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3944
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4911
Ophiocordyceps australis map64 (Brazil) OphauB2|343
Ophiocordyceps camponoti-floridani Ophcf2|04371
Ophiocordyceps camponoti-rufipedis Ophun1|4552 (this protein)
Ophiocordyceps kimflemingae Ophio5|352
Ophiocordyceps subramaniannii Hirsu2|7848

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4552
MVKSYLKYEHAKSFGVVVTGGSNIVWTSTDGTGAGQAVVAANEQVLCWDIKKGELLGRWKDERCAAPVTVVAQSK
TDKDVFAVGYGDGSIRLWDSKICNVIVNFNGHKSAVTKLVFDKSGVRLASGSKDTDVIIWDLVAEVGQYKLRGHK
DEVTGLHFVEPDPKVDDEEGTTATVTKGATSSDGFLLTSGKDSLLKLWDLSSRHCVETHIAQTNGECWALGMSPD
LSGCVTAGNDGEMKVWSLDVDALTASSQGVEASPTARYLLDRGTLHRQSKDRAIEVIFHPHRDYFAVHGSEKGVD
VWRIKTPAEIKKSLSRKRKRRREKQKDGKQADDGGEEEDHEDDAKAEIGDIFVQYVIVRTGGKVRSVDWALGGGQ
KDLKLLVGTTNNQLEYFSIPLKDKGDAKKKQEIPDYARALSVELAGHRTDIRALALSSDDKMVASAANGSMKIWN
VKTQACIRTFDCGYSLCCAFLPGDKVVVVGTKSGELQLFDVASSSLIDSVQAHEGSIWSLHVHPDGRSVVTGSAD
KTAKFWDFKIVQEEILGTKRTRPKLKLVQSRTLKVSDDVLSLRFSPDARLLAISLLDNTVKVFFVDTLKLYLNLY
GHKLPVLSMDISYDSKLIVTSSADKNIRIWGLDFGDCHKALFGHQDSILQVAFVPHNSDGNGHHFFSSSKDRTIR
YWDADKFEQIQRLDGHHGEVWSMAVSRSGTFLVSAGHDKCMRVWEESDEQIFLEEERERELEELYESTLTKSLEK
EPDLDDDDDGGGGGEVGAASKQTTETLMAGERIQEALELGMADLNLLREYEEAKLTNSNAPPPQRNMIFMALGNI
TAEEHLMTILQRIKASSLHDALLVLPFSAVPLLFTFLDLFAQRSMNIPLTCRILFFMIKTHHKQIVASRTMRTMM
DGIRVHLRGALRRQKDEMGVNMAALNVVGLQIRQSRVRDYVDGDFFKTLIDHVVTVELKNDIQLRGTLKSVDQYL
NIKLDDISVVEELKYPHLVRLSPPPNFIQRDIRSGGDCC*
Coding >Ophun1|4552
ATGGTCAAGTCCTACTTAAAGTACGAGCATGCCAAATCCTTCGGCGTCGTCGTGACGGGCGGCTCAAACATCGTC
TGGACTTCGACGGATGGCACAGGCGCAGGCCAGGCTGTGGTCGCCGCCAACGAGCAAGTCTTGTGCTGGGACATT
AAGAAGGGAGAGCTACTTGGCCGGTGGAAAGATGAGCGCTGCGCCGCTCCAGTCACCGTCGTGGCCCAGAGCAAG
ACGGACAAGGACGTCTTTGCCGTCGGATACGGAGACGGCAGCATCCGGCTTTGGGACAGCAAGATCTGCAACGTC
ATTGTCAACTTCAATGGCCACAAGTCAGCCGTCACGAAGCTTGTCTTTGATAAATCCGGCGTCCGGCTCGCCAGC
GGCTCCAAGGATACCGACGTCATCATATGGGATTTGGTTGCCGAGGTTGGCCAGTATAAGCTGCGAGGACACAAG
GATGAGGTGACGGGCTTGCATTTCGTCGAGCCGGACCCGAAAGTGGACGACGAAGAGGGAACCACGGCGACGGTG
ACCAAAGGTGCCACCTCCTCGGATGGCTTCCTCCTCACTTCCGGAAAGGACTCGCTACTCAAACTGTGGGACCTC
TCGTCGCGACACTGCGTGGAGACTCACATCGCCCAAACAAACGGCGAGTGCTGGGCCCTCGGAATGTCTCCGGAC
CTGAGCGGCTGCGTGACGGCGGGCAACGATGGCGAGATGAAGGTGTGGTCTCTAGACGTGGACGCCTTGACCGCC
AGCAGTCAAGGAGTTGAAGCTTCTCCCACAGCGCGCTACCTGTTGGATCGAGGAACTCTTCACAGGCAGAGCAAA
GACCGAGCCATCGAGGTCATCTTTCACCCTCACCGAGACTACTTTGCCGTCCACGGGTCGGAAAAGGGGGTCGAC
GTGTGGCGCATCAAGACGCCGGCGGAAATCAAGAAGAGCCTCTCACGGAAGCGAAAACGGCGCAGGGAAAAGCAA
AAGGATGGCAAGCAGGCCGACGACGGCGGCGAAGAGGAGGACCACGAGGACGACGCCAAGGCCGAGATCGGTGAC
ATCTTTGTCCAATATGTCATTGTCAGGACCGGAGGCAAGGTCCGTTCCGTCGACTGGGCCCTCGGCGGAGGACAG
AAAGACCTCAAGCTGTTGGTGGGAACGACAAACAACCAGTTGGAATACTTTAGCATACCGCTGAAAGACAAGGGC
GACGCGAAGAAGAAGCAAGAAATTCCCGACTACGCCCGCGCGCTTTCGGTCGAGCTGGCAGGCCACCGGACGGAC
ATCCGGGCGTTGGCCCTCAGCTCGGACGACAAGATGGTGGCATCAGCAGCCAACGGGTCCATGAAGATATGGAAC
GTAAAGACACAGGCTTGCATCCGGACCTTTGACTGCGGCTACTCCCTGTGCTGCGCCTTTCTACCCGGAGACAAA
GTAGTCGTGGTCGGGACCAAGAGCGGCGAGCTCCAGCTCTTTGACGTGGCTTCCTCGTCGCTCATCGACAGCGTA
CAGGCTCACGAGGGTTCCATCTGGTCGCTTCACGTGCATCCAGACGGCCGCTCCGTCGTGACGGGAAGCGCGGAC
AAGACGGCCAAGTTTTGGGATTTCAAGATTGTGCAAGAAGAAATCCTGGGCACCAAGAGAACAAGGCCCAAGCTG
AAGCTCGTCCAGTCCAGGACGCTCAAGGTGTCAGACGACGTCCTCAGCCTCCGCTTCTCACCCGACGCCCGGCTC
TTGGCCATCTCGCTGCTAGACAACACGGTAAAGGTCTTCTTCGTCGACACGCTAAAGCTCTACCTCAACCTCTAC
GGCCACAAACTCCCCGTCCTCAGCATGGACATCTCGTACGACAGCAAGCTGATAGTGACGAGCTCGGCGGACAAG
AACATTCGCATCTGGGGCCTCGACTTTGGAGACTGTCACAAGGCTCTTTTCGGACACCAGGACAGCATCCTGCAA
GTGGCCTTTGTCCCGCACAACTCGGACGGCAACGGCCACCACTTCTTCAGCAGCAGCAAGGACAGGACGATCCGC
TACTGGGACGCAGACAAGTTTGAGCAGATACAGAGGCTAGACGGCCATCACGGAGAAGTGTGGTCCATGGCCGTC
AGCCGGAGCGGCACCTTTTTGGTCAGCGCCGGTCACGACAAGTGCATGCGGGTGTGGGAGGAAAGCGACGAGCAG
ATCTTTCTCGAAGAGGAGCGAGAGAGGGAGCTGGAGGAGCTGTACGAGAGCACGCTGACCAAGTCGCTCGAGAAG
GAGCCGGATCTGGACGACGATGATGACGGCGGCGGTGGCGGCGAGGTCGGCGCTGCGAGCAAGCAGACGACGGAG
ACGCTCATGGCAGGCGAGAGGATCCAAGAAGCGCTGGAGCTGGGCATGGCCGACCTCAACCTCCTAAGGGAATAC
GAAGAAGCCAAGCTGACCAACAGCAACGCCCCGCCTCCCCAAAGGAACATGATCTTCATGGCCCTGGGCAACATC
ACAGCCGAAGAGCACCTAATGACCATCCTCCAACGCATCAAAGCCTCCTCCCTGCACGACGCCCTCCTCGTCCTC
CCCTTTTCCGCAGTCCCCCTGCTCTTCACCTTCCTAGACCTCTTCGCCCAGCGCAGCATGAACATTCCGCTCACG
TGCCGCATCCTCTTCTTCATGATCAAGACGCACCACAAGCAGATTGTCGCCAGCCGGACGATGCGCACCATGATG
GATGGGATTCGCGTGCACTTGCGGGGCGCGCTGCGCAGGCAGAAGGATGAGATGGGCGTCAACATGGCGGCTCTC
AATGTGGTGGGCTTGCAGATTCGTCAGTCGAGGGTTAGGGATTATGTTGATGGGGATTTCTTCAAAACGCTCATC
GACCACGTCGTAACCGTCGAGCTCAAAAACGACATCCAGCTCCGCGGCACCCTCAAAAGCGTAGACCAATACCTC
AACATCAAGCTCGATGACATTTCCGTCGTCGAGGAGCTCAAGTACCCGCATCTCGTGCGTCTCAGCCCTCCCCCC
AACTTTATCCAGAGGGATATCCGCAGTGGTGGTGATTGTTGCTGA
Transcript >Ophun1|4552
ATGGTCAAGTCCTACTTAAAGTACGAGCATGCCAAATCCTTCGGCGTCGTCGTGACGGGCGGCTCAAACATCGTC
TGGACTTCGACGGATGGCACAGGCGCAGGCCAGGCTGTGGTCGCCGCCAACGAGCAAGTCTTGTGCTGGGACATT
AAGAAGGGAGAGCTACTTGGCCGGTGGAAAGATGAGCGCTGCGCCGCTCCAGTCACCGTCGTGGCCCAGAGCAAG
ACGGACAAGGACGTCTTTGCCGTCGGATACGGAGACGGCAGCATCCGGCTTTGGGACAGCAAGATCTGCAACGTC
ATTGTCAACTTCAATGGCCACAAGTCAGCCGTCACGAAGCTTGTCTTTGATAAATCCGGCGTCCGGCTCGCCAGC
GGCTCCAAGGATACCGACGTCATCATATGGGATTTGGTTGCCGAGGTTGGCCAGTATAAGCTGCGAGGACACAAG
GATGAGGTGACGGGCTTGCATTTCGTCGAGCCGGACCCGAAAGTGGACGACGAAGAGGGAACCACGGCGACGGTG
ACCAAAGGTGCCACCTCCTCGGATGGCTTCCTCCTCACTTCCGGAAAGGACTCGCTACTCAAACTGTGGGACCTC
TCGTCGCGACACTGCGTGGAGACTCACATCGCCCAAACAAACGGCGAGTGCTGGGCCCTCGGAATGTCTCCGGAC
CTGAGCGGCTGCGTGACGGCGGGCAACGATGGCGAGATGAAGGTGTGGTCTCTAGACGTGGACGCCTTGACCGCC
AGCAGTCAAGGAGTTGAAGCTTCTCCCACAGCGCGCTACCTGTTGGATCGAGGAACTCTTCACAGGCAGAGCAAA
GACCGAGCCATCGAGGTCATCTTTCACCCTCACCGAGACTACTTTGCCGTCCACGGGTCGGAAAAGGGGGTCGAC
GTGTGGCGCATCAAGACGCCGGCGGAAATCAAGAAGAGCCTCTCACGGAAGCGAAAACGGCGCAGGGAAAAGCAA
AAGGATGGCAAGCAGGCCGACGACGGCGGCGAAGAGGAGGACCACGAGGACGACGCCAAGGCCGAGATCGGTGAC
ATCTTTGTCCAATATGTCATTGTCAGGACCGGAGGCAAGGTCCGTTCCGTCGACTGGGCCCTCGGCGGAGGACAG
AAAGACCTCAAGCTGTTGGTGGGAACGACAAACAACCAGTTGGAATACTTTAGCATACCGCTGAAAGACAAGGGC
GACGCGAAGAAGAAGCAAGAAATTCCCGACTACGCCCGCGCGCTTTCGGTCGAGCTGGCAGGCCACCGGACGGAC
ATCCGGGCGTTGGCCCTCAGCTCGGACGACAAGATGGTGGCATCAGCAGCCAACGGGTCCATGAAGATATGGAAC
GTAAAGACACAGGCTTGCATCCGGACCTTTGACTGCGGCTACTCCCTGTGCTGCGCCTTTCTACCCGGAGACAAA
GTAGTCGTGGTCGGGACCAAGAGCGGCGAGCTCCAGCTCTTTGACGTGGCTTCCTCGTCGCTCATCGACAGCGTA
CAGGCTCACGAGGGTTCCATCTGGTCGCTTCACGTGCATCCAGACGGCCGCTCCGTCGTGACGGGAAGCGCGGAC
AAGACGGCCAAGTTTTGGGATTTCAAGATTGTGCAAGAAGAAATCCTGGGCACCAAGAGAACAAGGCCCAAGCTG
AAGCTCGTCCAGTCCAGGACGCTCAAGGTGTCAGACGACGTCCTCAGCCTCCGCTTCTCACCCGACGCCCGGCTC
TTGGCCATCTCGCTGCTAGACAACACGGTAAAGGTCTTCTTCGTCGACACGCTAAAGCTCTACCTCAACCTCTAC
GGCCACAAACTCCCCGTCCTCAGCATGGACATCTCGTACGACAGCAAGCTGATAGTGACGAGCTCGGCGGACAAG
AACATTCGCATCTGGGGCCTCGACTTTGGAGACTGTCACAAGGCTCTTTTCGGACACCAGGACAGCATCCTGCAA
GTGGCCTTTGTCCCGCACAACTCGGACGGCAACGGCCACCACTTCTTCAGCAGCAGCAAGGACAGGACGATCCGC
TACTGGGACGCAGACAAGTTTGAGCAGATACAGAGGCTAGACGGCCATCACGGAGAAGTGTGGTCCATGGCCGTC
AGCCGGAGCGGCACCTTTTTGGTCAGCGCCGGTCACGACAAGTGCATGCGGGTGTGGGAGGAAAGCGACGAGCAG
ATCTTTCTCGAAGAGGAGCGAGAGAGGGAGCTGGAGGAGCTGTACGAGAGCACGCTGACCAAGTCGCTCGAGAAG
GAGCCGGATCTGGACGACGATGATGACGGCGGCGGTGGCGGCGAGGTCGGCGCTGCGAGCAAGCAGACGACGGAG
ACGCTCATGGCAGGCGAGAGGATCCAAGAAGCGCTGGAGCTGGGCATGGCCGACCTCAACCTCCTAAGGGAATAC
GAAGAAGCCAAGCTGACCAACAGCAACGCCCCGCCTCCCCAAAGGAACATGATCTTCATGGCCCTGGGCAACATC
ACAGCCGAAGAGCACCTAATGACCATCCTCCAACGCATCAAAGCCTCCTCCCTGCACGACGCCCTCCTCGTCCTC
CCCTTTTCCGCAGTCCCCCTGCTCTTCACCTTCCTAGACCTCTTCGCCCAGCGCAGCATGAACATTCCGCTCACG
TGCCGCATCCTCTTCTTCATGATCAAGACGCACCACAAGCAGATTGTCGCCAGCCGGACGATGCGCACCATGATG
GATGGGATTCGCGTGCACTTGCGGGGCGCGCTGCGCAGGCAGAAGGATGAGATGGGCGTCAACATGGCGGCTCTC
AATGTGGTGGGCTTGCAGATTCGTCAGTCGAGGGTTAGGGATTATGTTGATGGGGATTTCTTCAAAACGCTCATC
GACCACGTCGTAACCGTCGAGCTCAAAAACGACATCCAGCTCCGCGGCACCCTCAAAAGCGTAGACCAATACCTC
AACATCAAGCTCGATGACATTTCCGTCGTCGAGGAGCTCAAGTACCCGCATCTCGTGCGTCTCAGCCCTCCCCCC
AACTTTATCCAGAGGGATATCCGCAGTGGTGGTGATTGTTGCTGA
Gene >Ophun1|4552
ATGGTCAAGTCCTACTTGTAAGTCCGCTGGAGAGTGTGATAGAGAAGAATATTAATTGAACCCGCAGAAAGTACG
AGCATGCCAAATCCTTCGGCGTCGTCGTGACGGGCGGCTCAAACATCGTCTGGACTTCGACGGATGGCACAGGCG
CAGGCCAGGCTGTGGTCGCCGCCAACGAGCAAGTCTTGTGCTGGGACATTAAGAAGGGAGAGCTACTTGGCCGGT
GGAAAGATGAGCGCTGCGCCGCTCCAGTCACCGTCGTGGCCCAGAGCAAGACGGACAAGGACGTCTTTGCCGTCG
GATACGGAGACGGCAGCATCCGGCTTTGGGACAGCAAGATCTGCAACGTCATTGTCAACTTCAATGGCCACAAGT
CAGCCGTCACGAAGCTTGTCTTTGATAAATCCGGCGTCCGGCTCGCCAGCGGCTCCAAGGATACCGACGTCATCA
TATGGGATTTGGTTGCCGAGGTTGGCCAGTATAAGCTGCGAGGACACAAGGATGAGGTGACGGGCTTGCATTTCG
TCGAGCCGGACCCGAAAGTGGACGACGAAGAGGGAACCACGGCGACGGTGACCAAAGGTGCCACCTCCTCGGATG
GCTTCCTCCTCACTTCCGGAAAGGACTCGCTACTCAAACTGTGGGACCTCTCGTCGCGACACTGCGTGGAGACTC
ACATCGCCCAAACAAACGGCGAGTGCTGGGCCCTCGGAATGTCTCCGGACCTGAGCGGCTGCGTGACGGCGGGCA
ACGATGGCGAGATGAAGGTGTGGTCTCTAGACGTGGACGCCTTGACCGCCAGCAGTCAAGGAGTTGAAGCTTCTC
CCACAGCGCGCTACCTGTTGGATCGAGGAACTCTTCACAGGCAGAGCAAAGACCGAGCCATCGAGGTCATCTTTC
ACCCTCACCGAGACTACTTTGCCGTCCACGGGTCGGAAAAGGGGGTCGACGTGTGGCGCATCAAGACGCCGGCGG
AAATCAAGAAGAGCCTCTCACGGAAGCGAAAACGGCGCAGGGAAAAGCAAAAGGATGGCAAGCAGGCCGACGACG
GCGGCGAAGAGGAGGACCACGAGGACGACGCCAAGGCCGAGATCGGTGACATCTTTGTCCAATATGTCATTGTCA
GGACCGGAGGCAAGGTCCGTTCCGTCGACTGGGCCCTCGGCGGAGGACAGAAAGACCTCAAGCTGTTGGTGGGAA
CGACAAACAACCAGTTGGAATACTTTAGCATACCGCTGAAAGACAAGGGCGACGCGAAGAAGAAGCAAGAAATTC
CCGACTACGCCCGCGCGCTTTCGGTCGAGCTGGCAGGCCACCGGACGGACATCCGGGCGTTGGCCCTCAGCTCGG
ACGACAAGATGGTGGCATCAGCAGCCAACGGGTCCATGAAGATATGGAACGTAAAGACACAGGCTTGCATCCGGA
CCTTTGACTGCGGCTACTCCCTGTGCTGCGCCTTTCTACCCGGAGACAAAGTAGTCGTGGTCGGGACCAAGAGCG
GCGAGCTCCAGCTCTTTGACGTGGCTTCCTCGTCGCTCATCGACAGCGTACAGGCTCACGAGGGTTCCATCTGGT
CGCTTCACGTGCATCCAGACGGCCGCTCCGTCGTGACGGGAAGCGCGGACAAGACGGCCAAGTTTTGGGATTTCA
AGATTGTGCAAGAAGAAATCCTGGGCACCAAGAGAACAAGGCCCAAGCTGAAGCTCGTCCAGTCCAGGACGCTCA
AGGTGTCAGACGACGTCCTCAGCCTCCGCTTCTCACCCGACGCCCGGCTCTTGGCCATCTCGCTGCTAGACAACA
CGGTAAAGGTCTTCTTCGTCGACACGCTAAAGCTCTACCTCAACCTCTACGGCCACAAACTCCCCGTCCTCAGCA
TGGACATCTCGTACGACAGCAAGCTGATAGTGACGAGCTCGGCGGACAAGAACATTCGCATCTGGGGCCTCGACT
TTGGAGACTGTCACAAGGCTCTTTTCGGACACCAGGACAGCATCCTGCAAGTGGCCTTTGTCCCGCACAACTCGG
ACGGCAACGGCCACCACTTCTTCAGCAGCAGCAAGGACAGGACGATCCGCTACTGGGACGCAGACAAGTTTGAGC
AGATACAGAGGCTAGACGGCCATCACGGAGAAGTGTGGTCCATGGCCGTCAGCCGGAGCGGCACCTTTTTGGTCA
GCGCCGGTCACGACAAGTGCATGCGGGTGTGGGAGGAAAGCGACGAGCAGATCTTTCTCGAAGAGGAGCGAGAGA
GGGAGCTGGAGGAGCTGTACGAGAGCACGCTGACCAAGTCGCTCGAGAAGGAGCCGGATCTGGACGACGATGATG
ACGGCGGCGGTGGCGGCGAGGTCGGCGCTGCGAGCAAGCAGACGACGGAGACGCTCATGGCAGGCGAGAGGATCC
AAGAAGCGCTGGAGCTGGGCATGGCCGACCTCAACCTCCTAAGGGAATACGAAGAAGCCAAGCTGACCAACAGCA
ACGCCCCGCCTCCCCAAAGGAACATGATCTTCATGGCCCTGGGCAACATCACAGCCGAAGAGCACCTAATGACCA
TCCTCCAACGCATCAAAGCCTCCTCCCTGCACGACGCCCTCCTCGTCCTCCCCTTTTCCGCAGTCCCCCTGCTCT
TCACCTTCCTAGACCTCTTCGCCCAGCGCAGCATGAACATTCCGCTCACGTGCCGCATCCTCTTCTTCATGATCA
AGACGCACCACAAGCAGATTGTCGCCAGCCGGACGATGCGCACCATGATGGATGGGATTCGCGTGCACTTGCGGG
GCGCGCTGCGCAGGCAGAAGGATGAGATGGGCGTCAACATGGCGGCTCTCAATGTGGTGGGCTTGCAGATTCGTC
AGTCGAGGGTTAGGGATTATGTTGATGGGGAGTGGGTGGAGGAGAGGGCTGAGCAGAGGGCGAGGAAGAGGGCGT
TTGTGCATGTTGCGTAGATGCAAGTGGTTACTAGAAGAGAAGAAGCTATCGTGAATCGTCAGCTCTCCCTATGCT
TGTTAGTATAACTGTAAGTCTTGATGGTTGATCCCACCTATTCGTAGGTATCGTCAGGTTGTCTGATGTCGACAA
TGACGACGTTGGAGCGTGATGACCAACCCCTCACGTGACCCTCCTACATCCCCCCATCCACCCGCAAACCTCACC
ACCACGCTCCCCCAAACCGACACAATGCTCTTCTTCAGGCAAGCAACCTCCCCTCTCCCCTCTCATTCCCATGAC
GAATGCAGCTAACCCAAAAGGGCAGTTTCTTCAAAACGCTCATCGACCACGTCGTAACCGTCGAGCTCAAAAACG
ACATCCAGCTCCGCGGCACCCTCAAAAGCGTAGACCAATACCTCAACATCAAGCTCGATGACATTTCCGTCGTCG
AGGAGCTCAAGTACCCGCATCTCGTGCGTCTCAGCCCTCCCCCCAACTTTATCCAGAGGGATATCCGCAGTGGTG
GTGATTGTTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail