Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|455
Gene name
LocationContig_113:736..3520
Strand-
Gene length (bp)2784
Transcript length (bp)2193
Coding sequence length (bp)2193
Protein length (aa) 731

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00887 ACBP Acyl CoA binding protein 3.4E-23 6 94
PF02458 Transferase Transferase family 4.5E-10 381 564

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|C4R8D7|ATG37_PICPG Autophagy-related protein 37 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0602 PE=1 SV=1 1 165 8.0E-31
sp|Q20507|ACBP3_CAEEL Acyl-CoA-binding protein homolog 3 OS=Caenorhabditis elegans GN=acbp-3 PE=3 SV=2 4 117 2.0E-08
sp|Q3SZF0|ACBD7_BOVIN Acyl-CoA-binding domain-containing protein 7 OS=Bos taurus GN=ACBD7 PE=3 SV=1 9 102 1.0E-06
sp|P0C8L7|ACBP_HYPDU Putative acyl-CoA-binding protein OS=Hypsibius dujardini PE=3 SV=1 4 100 3.0E-06
sp|Q9D258|ACBD7_MOUSE Acyl-CoA-binding domain-containing protein 7 OS=Mus musculus GN=Acbd7 PE=3 SV=2 9 102 7.0E-06

GO

GO Term Description Terminal node
GO:0000062 fatty-acyl-CoA binding Yes
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0033218 amide binding No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:1901567 fatty acid derivative binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0120227 acyl-CoA binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901681 sulfur compound binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3038
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|312
Ophiocordyceps australis map64 (Brazil) OphauB2|3317
Ophiocordyceps camponoti-floridani Ophcf2|06713
Ophiocordyceps camponoti-rufipedis Ophun1|455 (this protein)
Ophiocordyceps kimflemingae Ophio5|2834
Ophiocordyceps subramaniannii Hirsu2|5265

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|455
MADSVDRVFVHALNTVKKIPKTGASRPPPQDRLRLYGLYKQAMEGDVDGVMEQPSPTPALTAEELQRERDKWHAW
NTQRGLSRTEAKRRYVEALIETMHRYATTSDATELVAELEFVWNQIRQNSSGSSDDCSPRAAKLHQSSTSGLIKV
LTPMSEQGQAEMRSPGCIDPGGDGSWQRSMNRAITNLSAEVAALREQIATGREWKSKKQRSLSAWLKWAVWKVSK
HIVADCFVLALVLLWLRRRRDTRFEDLVRAALKLGRDLQLFQVYSMTFVARFNDKLDPKKLHQSLLTLLEKDSWR
VLGGRLRRTEDGKLEIRVSKDQDAVTFKHSVIACDAEQDPTGRCMPTPVADGPQFLAVAPVCNVGITGWPVERMD
LSEFIKHSWPLLTVQVTTFNNATFVAISLPHVVMDGAGVGILLQNWSLVVNGREDEVCDLADNRDELYDRARQAS
TKSSDPTSDLELGTMPTGLSAVAFKLSVLLNRLLWNWVSGPIENRMFCLREKQLEKLVQAARQEHVNAEDRAPFI
STADVVSAWITRLVAKTMRLPQNLLVMIPVNNRPRLLPLKSGEDRSECILNTISAAYATLTRREAMGSLASIAHS
YRRRLQEQTRLPNLSRFWSGLKEQALIFGDAYLMPKGPYYSYMKIAFDNHSSADYRGRTNFAGAVIQRREMNGGT
KEPGTMVFYKLKLSSEICAWHMMHVFGKDLVGNYWMTMSLPRRTWSLIERELEAL*
Coding >Ophun1|455
ATGGCCGACTCAGTGGATCGAGTCTTCGTCCACGCCCTCAACACGGTCAAGAAGATACCCAAGACGGGCGCGTCA
CGACCCCCACCGCAGGACCGCCTGCGTCTATACGGCCTCTACAAGCAGGCCATGGAGGGTGACGTCGACGGCGTC
ATGGAGCAGCCCTCGCCGACGCCTGCGTTGACCGCCGAAGAGCTGCAAAGGGAGCGAGACAAGTGGCATGCCTGG
AATACTCAAAGAGGCCTGAGCCGTACAGAGGCCAAGCGGAGATATGTCGAGGCCCTCATCGAGACCATGCACCGC
TACGCCACCACATCGGATGCTACCGAGCTCGTAGCCGAACTCGAGTTCGTATGGAACCAGATCAGACAAAATTCG
TCTGGCTCATCAGACGACTGCTCGCCGCGGGCGGCTAAACTTCATCAGAGCAGCACCAGCGGCCTGATCAAGGTG
TTGACGCCCATGAGCGAGCAGGGCCAGGCTGAGATGCGCTCACCCGGCTGCATCGATCCCGGTGGCGACGGCAGT
TGGCAAAGAAGCATGAATCGTGCGATAACCAATCTCTCAGCCGAAGTGGCGGCGCTGCGGGAGCAGATTGCGACG
GGACGCGAGTGGAAGTCGAAAAAGCAACGTAGCTTGTCGGCCTGGCTCAAGTGGGCAGTGTGGAAGGTTTCCAAG
CACATCGTCGCCGACTGCTTCGTTCTAGCTCTTGTCCTGCTCTGGTTGCGGAGACGCAGGGACACGCGCTTCGAG
GACCTTGTGCGGGCGGCCCTCAAACTGGGCCGCGACCTGCAGTTGTTCCAAGTATACTCCATGACCTTCGTCGCC
CGCTTCAACGACAAGCTCGACCCCAAGAAACTGCACCAAAGCTTGCTGACCTTGCTTGAGAAGGACAGCTGGCGA
GTGCTAGGGGGGCGGCTCAGAAGAACGGAAGATGGGAAGCTCGAGATCCGCGTGTCCAAAGACCAAGACGCCGTT
ACATTCAAGCATAGCGTCATTGCCTGTGATGCTGAGCAAGACCCCACGGGGCGTTGCATGCCGACACCAGTAGCG
GACGGCCCCCAGTTCCTCGCGGTCGCACCGGTGTGTAACGTGGGCATCACAGGATGGCCAGTCGAACGGATGGAC
TTGTCGGAGTTTATCAAACATTCATGGCCCCTGTTGACAGTCCAAGTCACCACGTTCAACAACGCCACCTTCGTG
GCCATCTCTCTGCCTCATGTCGTCATGGACGGCGCGGGCGTAGGGATCCTGCTGCAAAACTGGTCGCTCGTCGTC
AACGGGAGGGAGGACGAGGTCTGCGACTTGGCCGACAACAGGGACGAGCTCTATGACCGGGCGCGACAAGCGAGC
ACCAAGTCATCCGACCCGACAAGTGACCTTGAATTGGGCACGATGCCCACGGGGCTTTCCGCTGTCGCCTTCAAG
CTCAGCGTGCTTTTGAATAGGCTCCTCTGGAACTGGGTGTCGGGTCCTATCGAAAACAGGATGTTCTGCTTACGG
GAGAAGCAGCTGGAGAAGTTGGTCCAGGCCGCCCGCCAGGAGCACGTCAATGCCGAGGACCGGGCCCCCTTCATC
TCGACCGCCGACGTGGTCTCAGCCTGGATCACTCGTCTCGTAGCAAAGACTATGCGCCTGCCGCAGAACTTACTT
GTGATGATCCCGGTAAACAATCGTCCCCGATTACTTCCACTGAAGTCCGGCGAAGATCGAAGCGAATGCATCCTC
AACACGATATCTGCTGCTTACGCAACCTTGACTCGGCGTGAAGCCATGGGCTCTTTGGCATCCATCGCTCACTCT
TATCGACGTCGGCTGCAAGAACAAACCCGGTTGCCAAATCTGAGCCGGTTCTGGTCTGGATTGAAGGAACAGGCT
CTTATTTTTGGCGACGCCTACTTGATGCCTAAGGGTCCCTATTATTCGTATATGAAGATCGCATTTGACAACCAC
AGCAGCGCAGACTACCGCGGTCGCACTAACTTTGCCGGTGCAGTCATCCAGCGACGAGAGATGAATGGAGGAACA
AAAGAGCCGGGGACCATGGTGTTCTATAAGTTGAAACTTAGCTCGGAAATATGTGCCTGGCATATGATGCATGTT
TTCGGCAAGGACCTCGTGGGAAACTACTGGATGACGATGTCACTCCCGCGACGGACCTGGTCCTTGATCGAGCGG
GAGCTGGAAGCGCTGTAG
Transcript >Ophun1|455
ATGGCCGACTCAGTGGATCGAGTCTTCGTCCACGCCCTCAACACGGTCAAGAAGATACCCAAGACGGGCGCGTCA
CGACCCCCACCGCAGGACCGCCTGCGTCTATACGGCCTCTACAAGCAGGCCATGGAGGGTGACGTCGACGGCGTC
ATGGAGCAGCCCTCGCCGACGCCTGCGTTGACCGCCGAAGAGCTGCAAAGGGAGCGAGACAAGTGGCATGCCTGG
AATACTCAAAGAGGCCTGAGCCGTACAGAGGCCAAGCGGAGATATGTCGAGGCCCTCATCGAGACCATGCACCGC
TACGCCACCACATCGGATGCTACCGAGCTCGTAGCCGAACTCGAGTTCGTATGGAACCAGATCAGACAAAATTCG
TCTGGCTCATCAGACGACTGCTCGCCGCGGGCGGCTAAACTTCATCAGAGCAGCACCAGCGGCCTGATCAAGGTG
TTGACGCCCATGAGCGAGCAGGGCCAGGCTGAGATGCGCTCACCCGGCTGCATCGATCCCGGTGGCGACGGCAGT
TGGCAAAGAAGCATGAATCGTGCGATAACCAATCTCTCAGCCGAAGTGGCGGCGCTGCGGGAGCAGATTGCGACG
GGACGCGAGTGGAAGTCGAAAAAGCAACGTAGCTTGTCGGCCTGGCTCAAGTGGGCAGTGTGGAAGGTTTCCAAG
CACATCGTCGCCGACTGCTTCGTTCTAGCTCTTGTCCTGCTCTGGTTGCGGAGACGCAGGGACACGCGCTTCGAG
GACCTTGTGCGGGCGGCCCTCAAACTGGGCCGCGACCTGCAGTTGTTCCAAGTATACTCCATGACCTTCGTCGCC
CGCTTCAACGACAAGCTCGACCCCAAGAAACTGCACCAAAGCTTGCTGACCTTGCTTGAGAAGGACAGCTGGCGA
GTGCTAGGGGGGCGGCTCAGAAGAACGGAAGATGGGAAGCTCGAGATCCGCGTGTCCAAAGACCAAGACGCCGTT
ACATTCAAGCATAGCGTCATTGCCTGTGATGCTGAGCAAGACCCCACGGGGCGTTGCATGCCGACACCAGTAGCG
GACGGCCCCCAGTTCCTCGCGGTCGCACCGGTGTGTAACGTGGGCATCACAGGATGGCCAGTCGAACGGATGGAC
TTGTCGGAGTTTATCAAACATTCATGGCCCCTGTTGACAGTCCAAGTCACCACGTTCAACAACGCCACCTTCGTG
GCCATCTCTCTGCCTCATGTCGTCATGGACGGCGCGGGCGTAGGGATCCTGCTGCAAAACTGGTCGCTCGTCGTC
AACGGGAGGGAGGACGAGGTCTGCGACTTGGCCGACAACAGGGACGAGCTCTATGACCGGGCGCGACAAGCGAGC
ACCAAGTCATCCGACCCGACAAGTGACCTTGAATTGGGCACGATGCCCACGGGGCTTTCCGCTGTCGCCTTCAAG
CTCAGCGTGCTTTTGAATAGGCTCCTCTGGAACTGGGTGTCGGGTCCTATCGAAAACAGGATGTTCTGCTTACGG
GAGAAGCAGCTGGAGAAGTTGGTCCAGGCCGCCCGCCAGGAGCACGTCAATGCCGAGGACCGGGCCCCCTTCATC
TCGACCGCCGACGTGGTCTCAGCCTGGATCACTCGTCTCGTAGCAAAGACTATGCGCCTGCCGCAGAACTTACTT
GTGATGATCCCGGTAAACAATCGTCCCCGATTACTTCCACTGAAGTCCGGCGAAGATCGAAGCGAATGCATCCTC
AACACGATATCTGCTGCTTACGCAACCTTGACTCGGCGTGAAGCCATGGGCTCTTTGGCATCCATCGCTCACTCT
TATCGACGTCGGCTGCAAGAACAAACCCGGTTGCCAAATCTGAGCCGGTTCTGGTCTGGATTGAAGGAACAGGCT
CTTATTTTTGGCGACGCCTACTTGATGCCTAAGGGTCCCTATTATTCGTATATGAAGATCGCATTTGACAACCAC
AGCAGCGCAGACTACCGCGGTCGCACTAACTTTGCCGGTGCAGTCATCCAGCGACGAGAGATGAATGGAGGAACA
AAAGAGCCGGGGACCATGGTGTTCTATAAGTTGAAACTTAGCTCGGAAATATGTGCCTGGCATATGATGCATGTT
TTCGGCAAGGACCTCGTGGGAAACTACTGGATGACGATGTCACTCCCGCGACGGACCTGGTCCTTGATCGAGCGG
GAGCTGGAAGCGCTGTAG
Gene >Ophun1|455
ATGGCCGACTCAGTGGGTGCGTCACCTGTCGGTTCAACCCCCCTGCCTATCTCGGCTGAACCGATACAGATCGAG
TCTTCGTCCACGCCCTCAACACGGTCAAGAAGATACCCAAGACGGGCGCGTCACGACCCCCACCGCAGGACCGCC
TGCGTCTATACGGCCTCTACAAGCAGGCCATGGAGGGTGACGTCGACGGCGTCATGGAGCAGCCCTCGCCGACGC
CTGCGTTGACCGCCGAAGAGCTGCAAAGGGAGCGAGACAAGTGGCATGCCTGGAATACTCAAAGAGGCCTGAGCC
GTACAGAGGCCAAGCGGAGATATGTCGAGGCCCTCATCGAGACCATGCACCGCTACGCCACCACATCGTCAGCCA
CCACCACCACCAGCCTTCATTTCCCTCACCGGGCCGCTGATGTCACTCTTCCAGGGATGCTACCGAGCTCGTAGC
CGAACTCGAGTTCGTATGGAACCAGATCAGACAAAATTCGTCTGGCTCATCAGACGACTGCTCGCCGCGGGCGGC
TAAACTTCATCAGAGCAGCACCAGCGGCCTGATCAAGGTGTTGACGCCCATGAGCGAGCAGGGCCAGGCTGAGAT
GCGCTCACCCGGCTGCATCGATCCCGGTGGCGACGGCAGTTGGCAAAGAAGCATGAATCGTGCGATAACCAATCT
CTCAGCCGAAGTGGCGGCGCTGCGGGAGCAGATTGCGACGGGACGCGAGTGGAAGTCGAAAAAGCAACGTAGCTT
GTCGGCCTGGCTCAAGTGGGCAGTGTGGAAGGTTTCCAAGCACATCGTCGCCGACTGCTTCGTTCTAGCTCTTGT
CCTGCTCTGGTTGCGGAGACGCAGGGACACGCGCTTCGAGGACCTTGTGCGGGCGGCCCTCAAACTGGGCCGCGA
GTATGCTCGAAGGATTCTTCCGTCTAGGTGACGCGGATATTTGATGGTCATCACGGCAGACTATTACGTGAGAGA
AGAGCAGCATTGACTCCTCTCGACAGTATTCTTCGACACGTTTCCGGACTTCATCATGTCAGACGGCAGTAAAGA
GGCGCCGCCGGCAAGCCCCCGTTACATATTGCAATGAGATTAGCGCACATGAGAACACAGTACAAATCTCAGATC
ACGACTTAACAAAGCGTGACAATCCCTGACGACTCTGCTGGATGGCTTGCCCTATAAGTACGCATAGGCACGCCC
ACGTCGGCATACTCGACGGTGGCCGCCATAGCTATGAAATCCTGAACGCACTCTACCATGGCGAACTCGATCACC
GAAGACTTCATTTATCCTGTCCATTGGTTCGACAGCCTGCAGTTGTTCCAAGTATACTCCATGACCTTCGTCGCC
CGCTTCAACGACAAGCTCGACCCCAAGAAACTGCACCAAAGCTTGCTGACCTTGCTTGAGAAGGACAGCTGGCGA
GTGCTAGGGGGGCGGCTCAGAAGAACGGTATGTTAGACCTCGCTGCAACCAGCCAGGACAAGTCCCAGTTTCGCT
TTGCCAACCATGGTCTAGGAAGATGGGAAGCTCGAGATCCGCGTGTCCAAAGACCAAGACGCCGTTACATTCAAG
CATAGCGTCATTGCCTGTGATGCTGAGCAAGACCCCACGGGGCGTTGCATGCCGACACCAGTAGCGGACGGCCCC
CAGTTCCTCGCGGTCGCACCGGTGTGTAACGTGGGCATCACAGGATGGCCAGTCGAACGGATGGACTTGTCGGAG
TTTATCAAACATTCATGGCCCCTGTTGACAGTCCAAGTCACCACGTTCAACAACGCCACCTTCGTGGCCATCTCT
CTGCCTCATGTCGTCATGGACGGCGCGGGCGTAGGGATCCTGCTGCAAAACTGGTCGCTCGTCGTCAACGGGAGG
GAGGACGAGGTCTGCGACTTGGCCGACAACAGGGACGAGCTCTATGACCGGGCGCGACAAGCGAGCACCAAGTCA
TCCGACCCGACAAGTGACCTTGAATTGGGCACGATGCCCACGGGGCTTTCCGCTGTCGCCTTCAAGCTCAGCGTG
CTTTTGAATAGGCTCCTCTGGAACTGGGTGTCGGGTCCTATCGAAAACAGGATGTTCTGCTTACGGGAGAAGCAG
CTGGAGAAGTTGGTCCAGGCCGCCCGCCAGGAGCACGTCAATGCCGAGGACCGGGCCCCCTTCATCTCGACCGCC
GACGTGGTCTCAGCCTGGATCACTCGTCTCGTAGCAAAGACTATGCGCCTGCCGCAGAACTTACTTGTGATGATC
CCGGTAAACAATCGTCCCCGATTACTTCCACTGAAGTCCGGCGAAGATCGAAGCGAATGCATCCTCAACACGATA
TCTGCTGCTTACGCAACCTTGACTCGGCGTGAAGCCATGGGCTCTTTGGCATCCATCGCTCACTCTTATCGACGT
CGGCTGCAAGAACAAACCCGGTTGCCAAATCTGAGCCGGTTCTGGTCTGGATTGAAGGAACAGGCTCTTATTTTT
GGCGACGCCTACTTGATGCCTAAGGGTCCCTATTATTCGTATATGAAGATCGCATTTGACAACCACAGCAGCGCA
GACTACCGCGGTCGCACTAACTTTGCCGGTGCAGTCATCCAGCGACGAGAGATGAATGGAGGAACAAAAGAGCCG
GGGACCATGGTGTTCTATAAGTTGAAACTTAGCTCGGAAATATGTGCCTGGCATATGATGCATGTTTTCGGCAAG
GACCTCGTGGGAAACTACTGGATGACGATGTCACTCCCGCGACGGACCTGGTCCTTGATCGAGCGGGAGCTGGAA
GCGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail