Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4539
Gene name
LocationContig_42:49280..52918
Strand+
Gene length (bp)3638
Transcript length (bp)2886
Coding sequence length (bp)2886
Protein length (aa) 962

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 8.6E-47 71 570

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 103 572 4.0E-17
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 99 573 2.0E-16
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 232 572 3.0E-16
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 86 572 2.0E-15
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 137 573 4.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 103 572 4.0E-17
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 99 573 2.0E-16
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 232 572 3.0E-16
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 86 572 2.0E-15
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 137 573 4.0E-15
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 145 567 7.0E-15
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 105 568 9.0E-15
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 137 573 1.0E-14
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 267 570 1.0E-14
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 125 573 2.0E-14
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 288 573 2.0E-14
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 295 604 2.0E-14
sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 140 569 6.0E-14
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 125 458 7.0E-14
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 226 567 8.0E-14
sp|Q9LUC6|C7A14_ARATH Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 86 569 1.0E-13
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 267 570 1.0E-13
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 267 570 1.0E-13
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 125 561 1.0E-13
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 226 572 2.0E-13
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 121 573 2.0E-13
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 140 565 2.0E-13
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 125 567 2.0E-13
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 288 458 4.0E-13
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 281 567 4.0E-13
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 90 573 6.0E-13
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 334 570 6.0E-13
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 125 567 9.0E-13
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 125 458 9.0E-13
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 125 458 1.0E-12
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 99 567 1.0E-12
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 275 567 1.0E-12
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 131 573 2.0E-12
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 125 567 2.0E-12
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 145 569 2.0E-12
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 109 569 2.0E-12
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 295 568 2.0E-12
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 327 569 3.0E-12
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 145 567 4.0E-12
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 90 569 4.0E-12
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 131 458 6.0E-12
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 81 568 8.0E-12
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 325 568 8.0E-12
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 304 567 8.0E-12
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 83 568 9.0E-12
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 125 567 9.0E-12
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 321 479 9.0E-12
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 112 568 1.0E-11
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 275 570 1.0E-11
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 125 568 1.0E-11
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 226 567 2.0E-11
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 295 567 2.0E-11
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 282 580 2.0E-11
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 321 568 2.0E-11
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 282 580 2.0E-11
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 125 567 3.0E-11
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 263 568 3.0E-11
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 295 568 3.0E-11
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 125 567 3.0E-11
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 140 569 3.0E-11
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 105 568 4.0E-11
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 267 580 5.0E-11
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 81 568 5.0E-11
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 295 568 5.0E-11
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 125 568 7.0E-11
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 312 580 8.0E-11
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 290 568 9.0E-11
sp|Q27698|CP6D1_MUSDO Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 140 568 9.0E-11
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 325 568 1.0E-10
sp|Q9VMT6|C28D2_DROME Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 301 570 1.0E-10
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 295 568 2.0E-10
sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 262 569 2.0E-10
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 325 580 2.0E-10
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 295 604 2.0E-10
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 327 569 2.0E-10
sp|H2DH17|C7A22_PANGI Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 79 476 3.0E-10
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 325 568 3.0E-10
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 308 561 5.0E-10
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 289 580 5.0E-10
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 257 568 5.0E-10
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 273 567 6.0E-10
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 145 567 7.0E-10
sp|P49602|CP51_USTMA Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 137 570 9.0E-10
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 80 569 1.0E-09
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 295 568 1.0E-09
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 321 567 1.0E-09
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 140 568 1.0E-09
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 321 604 1.0E-09
sp|Q9LUC9|C7A11_ARATH Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 86 569 1.0E-09
sp|H2DH21|C7A29_PANGI Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 94 569 1.0E-09
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 240 567 2.0E-09
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 321 568 2.0E-09
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 287 567 3.0E-09
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 295 568 3.0E-09
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 325 568 3.0E-09
sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 299 569 4.0E-09
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 329 567 4.0E-09
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 273 477 5.0E-09
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 327 563 8.0E-09
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 325 568 9.0E-09
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 288 565 9.0E-09
sp|Q27664|CP6B2_HELAM Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 262 568 1.0E-08
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 325 568 3.0E-08
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 295 568 3.0E-08
sp|Q6VVX0|CP2R1_HUMAN Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 275 569 3.0E-08
sp|Q95031|CP6B6_HELAM Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 262 568 3.0E-08
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 55 567 3.0E-08
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 286 573 3.0E-08
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 259 570 9.0E-08
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 294 572 1.0E-07
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 295 599 2.0E-07
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 276 476 3.0E-07
sp|P14263|CP51_CANTR Lanosterol 14-alpha demethylase OS=Candida tropicalis GN=ERG11 PE=3 SV=2 257 583 3.0E-07
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 272 409 6.0E-07
sp|P97720|C11B1_MESAU Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 208 592 9.0E-07
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 295 477 1.0E-06
sp|P10613|CP51_CANAL Lanosterol 14-alpha demethylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG11 PE=3 SV=2 257 561 2.0E-06
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 285 570 2.0E-06
sp|Q8GSQ1|C85A1_ORYSJ Cytochrome P450 85A1 OS=Oryza sativa subsp. japonica GN=CYP85A1 PE=1 SV=1 285 485 4.0E-06
sp|Q7Z1V1|CP51_TRYCC Sterol 14-alpha demethylase OS=Trypanosoma cruzi (strain CL Brener) GN=CYP51 PE=1 SV=1 246 461 4.0E-06
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 289 477 5.0E-06
sp|Q02315|CP51_PICKU Lanosterol 14-alpha demethylase (Fragment) OS=Pichia kudriavzevii GN=CYP51 PE=3 SV=1 287 476 6.0E-06
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 272 409 6.0E-06
sp|O87605|PIKC_STRVZ Cytochrome P450 monooxygenase PikC OS=Streptomyces venezuelae GN=pikC PE=1 SV=1 288 443 8.0E-06
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 325 479 8.0E-06
sp|Q9VWR2|CP308_DROME Probable cytochrome P450 308a1 OS=Drosophila melanogaster GN=Cyp308a1 PE=2 SV=2 306 477 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 860 882 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4539
MQTLVVMAVLGLAWAVYRYVSALRRSVAQARNSGLPYVVVPWHPIFWLSRLSHKIWVPTVQMLLPWSWWERWLDL
MVPDIMFRTGFERFKRHGDSFLVVWPGGHLLHTANAEMIRQMTQRREHFPKWTASYGILRQFGENVVTSEGSVWR
THRKMTSASFNERNAALVFREAVVQTQGMIRAWERRGQTALRCVDRDTMRLALNIIGYVGFGLRLLWPGQEVPSG
LDSRLARYASLSPPEGHSLSFVDTMAGLMENLLPLLLLPRWILRTWPATRKATVAYDDYVAYMDELLADKERRLG
QQQGEGGMDLMGSLVRTAYGTKNGLTRDDIIGNAFVMFLAGHETSANVLHFSMLHLAARPEAQRMLQRDIDRLVG
DADPADWDYDELFNGMAASMIGACMNEELRIMPPVTELPKKVTPTQDQYVTADGHRYVIPRDTVISLAVVSVQQN
PRYWPHGESRVRPGCDDLRDFRPERWLLERQTSSPASPPASPLSSSSLSSSPPGSASSSAPTTAPDTDENLLTPS
LFRPERGAYIPFSDGARSCLGRRIAQAEIIAALAVLFRQYSLELDVGEWADETEVEAMSKEEKRRVYGLAQKRSR
LVMEEARTLVTLKLHSGQHVPVRMVPRGSERQRKSELLELAESLGMTDVDGLKKTELEVAIDEFIPRHAAALAER
SDLAGYFASRSRALGSPVKRAVTTTAEESDGGRGSRGSRRRARASVMAAPVEASPAATSSEEDSSGKSSVMVRTP
PPNNLSLAPALPATPADVAQAVERSTTAMRRRVSTIYRESGLPSASRTARQTLASVNTMILCVTTLELVFIRAEI
LADRYAFTIPALPALATTAYPVSLPDMFLLLTSSFWIPASTWILTSVLLPCLAGYLFNLRAASPLANDVSPIDPL
VYSMAKALVAYTVYGHGATLGVLDGRAVERLEGAVCGGYRGVLIGTAVTALVSLYDAVLRR*
Coding >Ophun1|4539
ATGCAGACGCTGGTGGTGATGGCGGTCCTGGGCCTCGCCTGGGCAGTCTACCGCTATGTGTCGGCGCTGAGGCGC
AGCGTGGCCCAGGCGCGGAACAGCGGGCTGCCCTACGTTGTCGTCCCGTGGCATCCCATTTTCTGGCTCTCGCGG
CTATCTCACAAGATATGGGTGCCGACGGTGCAGATGCTTCTGCCGTGGAGCTGGTGGGAGCGATGGCTAGACCTC
ATGGTGCCCGACATCATGTTCCGGACCGGGTTCGAGCGCTTCAAGCGACACGGCGACTCATTTCTCGTCGTCTGG
CCCGGCGGCCACTTGCTTCACACGGCCAACGCGGAGATGATCCGGCAGATGACGCAGCGGAGAGAACACTTTCCC
AAGTGGACGGCTTCATACGGGATCCTGCGGCAGTTTGGCGAGAACGTGGTGACTTCGGAGGGATCGGTGTGGCGG
ACGCATCGCAAGATGACGTCTGCGTCCTTCAACGAGCGCAACGCCGCCCTCGTCTTCCGCGAAGCCGTGGTGCAG
ACCCAAGGCATGATCCGGGCGTGGGAGAGGCGCGGACAGACGGCTCTGCGGTGCGTCGACCGAGACACGATGCGG
CTGGCCCTCAACATCATCGGCTACGTCGGCTTCGGGCTCCGGCTGCTGTGGCCGGGTCAGGAGGTGCCGTCCGGG
CTGGATTCGCGGCTGGCACGGTACGCGTCGCTGTCACCGCCCGAGGGCCACTCGCTGAGCTTCGTCGACACCATG
GCCGGCCTCATGGAGAACCTGCTGCCGCTGCTGCTGCTGCCGCGCTGGATCCTGCGGACTTGGCCGGCCACACGC
AAGGCGACGGTCGCCTACGACGACTATGTCGCTTACATGGATGAGCTGCTGGCCGACAAGGAGCGGCGGTTAGGC
CAGCAACAGGGAGAAGGGGGCATGGACCTGATGGGCAGCCTGGTACGAACCGCGTACGGCACCAAGAACGGGCTG
ACGCGAGACGACATCATCGGCAACGCCTTCGTCATGTTCCTCGCCGGTCACGAGACGTCGGCCAACGTGCTGCAC
TTCTCCATGCTGCATCTCGCCGCTCGGCCCGAGGCTCAGCGCATGCTGCAGCGTGACATTGACCGTTTGGTCGGT
GATGCGGACCCGGCCGATTGGGACTACGACGAGCTGTTCAACGGCATGGCGGCCAGCATGATTGGCGCCTGCATG
AACGAGGAACTGCGCATCATGCCGCCCGTCACCGAGCTGCCCAAGAAGGTGACGCCCACGCAAGACCAGTACGTG
ACGGCCGACGGACATCGCTATGTGATTCCCCGCGACACCGTCATCTCGCTGGCCGTCGTGTCGGTTCAGCAGAAT
CCGAGGTACTGGCCTCATGGCGAGAGCCGCGTGCGGCCTGGCTGCGATGACCTGCGCGATTTCCGACCCGAGCGG
TGGCTACTGGAGCGACAGACCAGCTCTCCGGCTTCGCCCCCGGCTTCGCCTTTGTCTTCTTCTTCGTTGTCGTCG
TCTCCGCCGGGGTCAGCATCCTCTTCGGCTCCGACCACAGCGCCGGATACAGACGAAAACCTCCTGACACCATCG
CTCTTCCGTCCCGAGCGCGGAGCCTACATCCCCTTTAGCGACGGGGCGCGCTCGTGTCTCGGTCGCCGCATCGCG
CAGGCCGAGATCATTGCCGCGCTGGCCGTCCTCTTCCGCCAATACAGCCTCGAGCTCGACGTGGGCGAATGGGCC
GACGAGACGGAGGTGGAGGCCATGTCCAAGGAGGAAAAGAGGCGCGTGTACGGGCTGGCGCAGAAGCGTAGCAGG
CTGGTGATGGAGGAGGCGCGGACGCTGGTGACGCTCAAGCTACATAGTGGGCAGCACGTGCCTGTGAGGATGGTG
CCGAGGGGGAGTGAGCGGCAGCGCAAGAGCGAGCTCTTGGAGCTGGCCGAGAGCCTGGGGATGACTGACGTCGAC
GGGCTCAAGAAGACGGAGCTTGAGGTTGCCATCGATGAGTTTATCCCCAGGCATGCTGCTGCCTTGGCCGAGAGG
TCGGATCTTGCGGGCTACTTCGCCAGTCGATCGCGGGCGCTGGGCTCGCCGGTGAAACGCGCCGTCACCACGACG
GCTGAGGAATCGGATGGGGGGAGGGGGTCGAGGGGGTCGAGGAGGAGGGCTCGCGCTTCGGTCATGGCTGCTCCT
GTTGAGGCCTCGCCCGCAGCTACGAGTTCCGAAGAGGACAGCAGTGGGAAGAGCTCCGTGATGGTGCGCACGCCG
CCGCCCAACAACCTCTCGCTTGCGCCCGCCCTGCCCGCCACGCCCGCGGATGTAGCGCAGGCGGTCGAGCGATCG
ACGACGGCGATGCGAAGACGCGTCTCCACCATCTATCGCGAGAGCGGCCTCCCCAGCGCATCGCGCACAGCCCGC
CAGACCCTCGCGTCGGTAAACACCATGATCCTCTGCGTCACCACGCTCGAACTCGTCTTCATCCGCGCCGAGATC
CTCGCCGATCGCTACGCCTTCACCATCCCCGCCCTCCCCGCCCTCGCAACGACCGCCTACCCCGTCAGCCTGCCA
GACATGTTCCTCCTCCTCACCTCGAGCTTCTGGATCCCCGCCTCGACCTGGATCCTCACCTCCGTGCTCCTCCCC
TGTCTGGCCGGCTACCTCTTCAACCTGCGCGCCGCGTCCCCGCTCGCCAACGACGTGTCGCCCATCGACCCGCTC
GTCTACAGCATGGCGAAAGCCCTCGTCGCCTACACCGTCTACGGCCACGGCGCCACGCTGGGCGTCCTGGATGGT
CGCGCTGTGGAGCGGCTTGAGGGCGCCGTCTGTGGGGGGTATCGTGGCGTGCTGATTGGGACGGCTGTCACGGCG
CTGGTTAGCTTGTACGATGCTGTGCTGAGGCGGTGA
Transcript >Ophun1|4539
ATGCAGACGCTGGTGGTGATGGCGGTCCTGGGCCTCGCCTGGGCAGTCTACCGCTATGTGTCGGCGCTGAGGCGC
AGCGTGGCCCAGGCGCGGAACAGCGGGCTGCCCTACGTTGTCGTCCCGTGGCATCCCATTTTCTGGCTCTCGCGG
CTATCTCACAAGATATGGGTGCCGACGGTGCAGATGCTTCTGCCGTGGAGCTGGTGGGAGCGATGGCTAGACCTC
ATGGTGCCCGACATCATGTTCCGGACCGGGTTCGAGCGCTTCAAGCGACACGGCGACTCATTTCTCGTCGTCTGG
CCCGGCGGCCACTTGCTTCACACGGCCAACGCGGAGATGATCCGGCAGATGACGCAGCGGAGAGAACACTTTCCC
AAGTGGACGGCTTCATACGGGATCCTGCGGCAGTTTGGCGAGAACGTGGTGACTTCGGAGGGATCGGTGTGGCGG
ACGCATCGCAAGATGACGTCTGCGTCCTTCAACGAGCGCAACGCCGCCCTCGTCTTCCGCGAAGCCGTGGTGCAG
ACCCAAGGCATGATCCGGGCGTGGGAGAGGCGCGGACAGACGGCTCTGCGGTGCGTCGACCGAGACACGATGCGG
CTGGCCCTCAACATCATCGGCTACGTCGGCTTCGGGCTCCGGCTGCTGTGGCCGGGTCAGGAGGTGCCGTCCGGG
CTGGATTCGCGGCTGGCACGGTACGCGTCGCTGTCACCGCCCGAGGGCCACTCGCTGAGCTTCGTCGACACCATG
GCCGGCCTCATGGAGAACCTGCTGCCGCTGCTGCTGCTGCCGCGCTGGATCCTGCGGACTTGGCCGGCCACACGC
AAGGCGACGGTCGCCTACGACGACTATGTCGCTTACATGGATGAGCTGCTGGCCGACAAGGAGCGGCGGTTAGGC
CAGCAACAGGGAGAAGGGGGCATGGACCTGATGGGCAGCCTGGTACGAACCGCGTACGGCACCAAGAACGGGCTG
ACGCGAGACGACATCATCGGCAACGCCTTCGTCATGTTCCTCGCCGGTCACGAGACGTCGGCCAACGTGCTGCAC
TTCTCCATGCTGCATCTCGCCGCTCGGCCCGAGGCTCAGCGCATGCTGCAGCGTGACATTGACCGTTTGGTCGGT
GATGCGGACCCGGCCGATTGGGACTACGACGAGCTGTTCAACGGCATGGCGGCCAGCATGATTGGCGCCTGCATG
AACGAGGAACTGCGCATCATGCCGCCCGTCACCGAGCTGCCCAAGAAGGTGACGCCCACGCAAGACCAGTACGTG
ACGGCCGACGGACATCGCTATGTGATTCCCCGCGACACCGTCATCTCGCTGGCCGTCGTGTCGGTTCAGCAGAAT
CCGAGGTACTGGCCTCATGGCGAGAGCCGCGTGCGGCCTGGCTGCGATGACCTGCGCGATTTCCGACCCGAGCGG
TGGCTACTGGAGCGACAGACCAGCTCTCCGGCTTCGCCCCCGGCTTCGCCTTTGTCTTCTTCTTCGTTGTCGTCG
TCTCCGCCGGGGTCAGCATCCTCTTCGGCTCCGACCACAGCGCCGGATACAGACGAAAACCTCCTGACACCATCG
CTCTTCCGTCCCGAGCGCGGAGCCTACATCCCCTTTAGCGACGGGGCGCGCTCGTGTCTCGGTCGCCGCATCGCG
CAGGCCGAGATCATTGCCGCGCTGGCCGTCCTCTTCCGCCAATACAGCCTCGAGCTCGACGTGGGCGAATGGGCC
GACGAGACGGAGGTGGAGGCCATGTCCAAGGAGGAAAAGAGGCGCGTGTACGGGCTGGCGCAGAAGCGTAGCAGG
CTGGTGATGGAGGAGGCGCGGACGCTGGTGACGCTCAAGCTACATAGTGGGCAGCACGTGCCTGTGAGGATGGTG
CCGAGGGGGAGTGAGCGGCAGCGCAAGAGCGAGCTCTTGGAGCTGGCCGAGAGCCTGGGGATGACTGACGTCGAC
GGGCTCAAGAAGACGGAGCTTGAGGTTGCCATCGATGAGTTTATCCCCAGGCATGCTGCTGCCTTGGCCGAGAGG
TCGGATCTTGCGGGCTACTTCGCCAGTCGATCGCGGGCGCTGGGCTCGCCGGTGAAACGCGCCGTCACCACGACG
GCTGAGGAATCGGATGGGGGGAGGGGGTCGAGGGGGTCGAGGAGGAGGGCTCGCGCTTCGGTCATGGCTGCTCCT
GTTGAGGCCTCGCCCGCAGCTACGAGTTCCGAAGAGGACAGCAGTGGGAAGAGCTCCGTGATGGTGCGCACGCCG
CCGCCCAACAACCTCTCGCTTGCGCCCGCCCTGCCCGCCACGCCCGCGGATGTAGCGCAGGCGGTCGAGCGATCG
ACGACGGCGATGCGAAGACGCGTCTCCACCATCTATCGCGAGAGCGGCCTCCCCAGCGCATCGCGCACAGCCCGC
CAGACCCTCGCGTCGGTAAACACCATGATCCTCTGCGTCACCACGCTCGAACTCGTCTTCATCCGCGCCGAGATC
CTCGCCGATCGCTACGCCTTCACCATCCCCGCCCTCCCCGCCCTCGCAACGACCGCCTACCCCGTCAGCCTGCCA
GACATGTTCCTCCTCCTCACCTCGAGCTTCTGGATCCCCGCCTCGACCTGGATCCTCACCTCCGTGCTCCTCCCC
TGTCTGGCCGGCTACCTCTTCAACCTGCGCGCCGCGTCCCCGCTCGCCAACGACGTGTCGCCCATCGACCCGCTC
GTCTACAGCATGGCGAAAGCCCTCGTCGCCTACACCGTCTACGGCCACGGCGCCACGCTGGGCGTCCTGGATGGT
CGCGCTGTGGAGCGGCTTGAGGGCGCCGTCTGTGGGGGGTATCGTGGCGTGCTGATTGGGACGGCTGTCACGGCG
CTGGTTAGCTTGTACGATGCTGTGCTGAGGCGGTGA
Gene >Ophun1|4539
ATGCAGACGCTGGTGGTGATGGCGGTCCTGGGCCTCGCCTGGGCAGTCTACCGCTATGTGTCGGCGCTGAGGCGC
AGCGTGGCCCAGGCGCGGAACAGCGGGCTGCCCTACGTTGTCGTCCGTACGTGTTTCCCTGCTGGCGATGGAGGA
GGACGAGGCTGACGATTGAGAGCAGCGTGGCATCCCATTTTCTGGCTCTCGCGGCTATCTCACAAGATATGGGTG
CCGACGGTGCAGATGCTTCTGCCGTGGAGCTGGTGGGAGCGATGGCTAGAGTCCGTTCTCTCTCTCTCTCTCTCT
TCTCTCGGTCAAGGGAGACGTGCTGACGGTTGGCAACAGCCTCATGGTGCCCGACATCATGTTCCGGACCGGGTT
CGAGCGCTTCAAGCGACACGGCGACTCATTTCTCGTCGTCTGGCCCGGCGGCCACTTGCTTCACACGGCCAACGC
GGAGATGATCCGGCAGATGACGCAGCGGAGAGAACACTTTCCCAAGTGGACGGCTTCATACGGGATCCTGCGGCA
GTTTGGCGAGAACGTGGTGACTTCGGAGGGATCGGTGTGGCGGACGCATCGCAAGATGACGTCTGCGTCCTTCAA
CGAGCGCAACGCCGCCCTCGTCTTCCGCGAAGCCGTGGTGCAGACCCAAGGCATGATCCGGGCGTGGGAGAGGCG
CGGACAGACGGCTCTGCGGTGCGTCGACCGAGACACGATGCGGCTGGCCCTCAACATCATCGGCTACGTCGGCTT
CGGGCTCCGGCTGCTGTGGCCGGGTCAGGAGGTGCCGTCCGGGCTGGATTCGCGGCTGGCACGGTACGCGTCGCT
GTCACCGCCCGAGGGCCACTCGCTGAGCTTCGTCGACACCATGGCCGGCCTCATGGAGAACCTGCTGCCGCTGCT
GCTGCTGCCGCGCTGGATCCTGCGGACTTGGCCGGCCACACGCAAGGCGACGGTCGCCTACGACGACTATGTCGC
TTACATGGATGAGCTGCTGGCCGACAAGGAGCGGCGGTTAGGCCAGCAACAGGGAGAAGGGGGCATGGACCTGAT
GGGCAGCCTGGTACGAACCGCGTACGGCACCAAGAACGGGCTGACGCGAGACGACATCATCGGCAACGCCTTCGT
CATGTTCCTCGCCGGTCACGAGACGTCGGCCAACGTGCTGCACTTCTCCATGCTGCATCTCGCCGCTCGGCCCGA
GGCTCAGCGCATGCTGCAGCGTGACATTGACCGTTTGGTCGGTGATGCGGACCCGGCCGATTGGGACTACGACGA
GCTGTTCAACGGCATGGCGGCCAGCATGATTGGCGCCTGCATGAACGAGGAACTGCGCATCATGCCGCCCGTCAC
CGAGCTGCCCAAGAAGGTGACGCCCACGCAAGACCAGTACGTGACGGCCGACGGACATCGCTATGTGATTCCCCG
CGACACCGTCATCTCGCTGGCCGTCGTGTCGGTTCAGCAGAATCCGAGGTACTGGCCTCATGGCGAGAGCCGCGT
GCGGCCTGGCTGCGATGACCTGCGCGATTTCCGACCCGAGCGGTGGCTACTGGAGCGACAGACCAGCTCTCCGGC
TTCGCCCCCGGCTTCGCCTTTGTCTTCTTCTTCGTTGTCGTCGTCTCCGCCGGGGTCAGCATCCTCTTCGGCTCC
GACCACAGCGCCGGATACAGACGAAAACCTCCTGACACCATCGCTCTTCCGTCCCGAGCGCGGAGCCTACATCCC
CTTTAGCGACGGGGCGCGCTCGTGTCTCGGTCGCCGCATCGCGCAGGCCGAGATCATTGCCGCGCTGGCCGTCCT
CTTCCGCCAATACAGCCTCGAGCTCGACGTGGGCGAATGGGCCGACGAGACGGAGGTGGAGGCCATGTCCAAGGA
GGAAAAGAGGCGCGTGTACGGGCTGGCGCAGAAGCGTAGCAGGCTGGTGATGGAGGAGGCGCGGACGCTGGTGAC
GCTCAAGCTACATAGTGGGCAGCACGTGCCTGTGAGGATGGTGCCGAGGGGGAGTGAGCGGTTCGTGAATTGGTT
GGAAGATGAGATGTAATGGTATTGATCGTGGTCGTGGTCGTCTTCATGTTTGTGGTGTTTTGAAGGTTTGGTTGC
TTTAGTCTCGTCTACCTATGGAATGCACGTGACATGGGAGAGGAGCGCGTTCCCACACAAGCCACAGGGAGCTCC
GCCCCCCGCACCAAGCCACAATGCCAATTTCTCCGAACGAACAGCCGAAGCCCCCCATGACCCGAAAAACATAAT
CAAAACAATAAACAAGCAGACACCAGCCTCACGCGCCTCATCGCAACAACCGCATCCAACGTCACCGCCACCCTT
TACTCTTCAACACGCGCCATCGCAAACAAAAATCAAGAAAAAAAAAAGAAAGAGAGAGAAACTCACCATCCAGTG
CTCGTCGCGCCGAAAGACGAGGTATCGTGAAAGCGACGCGCGACTGGGGGAGGGCAATCCGAGAGAGAGAGAGAG
AGAGAGAGGTCCATCATGGCGAGCTGGTTGAACAGGCAGCGCAAGAGCGAGCTCTTGGAGCTGGCCGAGAGCCTG
GGGATGACTGAGTACGCCAAACCCCTTGACACGCAGAAGCAGCAAAGCAAAAGCTGACCATCAGAGTCTCGCAGC
GTCGACGGGCTCAAGAAGACGGAGCTTGAGGTTGCCATCGATGAGTTTATCCCCAGGCATGCTGCTGCCTTGGCC
GAGAGGTCGGATCTTGCGGGCTACTTCGCCAGTCGATCGCGGGCGCTGGGCTCGCCGGTGAAACGCGCCGTCACC
ACGACGGCTGAGGAATCGGATGGGGGGAGGGGGTCGAGGGGGTCGAGGAGGAGGGCTCGCGCTTCGGTCATGGCT
GCTCCTGTTGAGGCCTCGCCCGCAGCTACGAGTTCCGAGTTCGTGTCTTTCCCCTTTTACCTACCTCCCGACGAC
GCGAGGAATCTGGACTGCTAACCTTGGGAATCAGAGAGGACAGCAGTGGGAAGAGCTCCGTGATGGTGCGCACGC
CGCCGCCCAACAACCTCTCGCTTGCGCCCGCCCTGCCCGCCACGCCCGCGGATGTAGCGCAGGCGGTCGAGCGAT
CGACGACGGCGATGCGAAGACGCGTCTCCACCATCTATCGCGAGAGCGGCCTCCCCAGCGCATCGCGCACAGCCC
GCCAGACCCTCGCGTCGGTAAACACCATGATCCTCTGCGTCACCACGCTCGAACTCGTCTTCATCCGCGCCGAGA
TCCTCGCCGATCGCTACGCCTTCACCATCCCCGCCCTCCCCGCCCTCGCAACGACCGCCTACCCCGTCAGCCTGC
CAGACATGTTCCTCCTCCTCACCTCGAGCTTCTGGATCCCCGCCTCGACCTGGATCCTCACCTCCGTGCTCCTCC
CCTGTCTGGCCGGCTACCTCTTCAACCTGCGCGCCGCGTCCCCGCTCGCCAACGACGTGTCGCCCATCGACCCGC
TCGTCTACAGCATGGCGAAAGCCCTCGTCGCCTACACCGTCTACGGCCACGGCGCCACGCTGGGCGTCCTGGATG
GTCGCGCTGTGGAGCGGCTTGAGGGCGCCGTCTGTGGGGGGTATCGTGGCGTGCTGATTGGGACGGCTGTCACGG
CGCTGGTTAGCTTGTACGATGCTGTGCTGAGGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail