Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4538
Gene name
LocationContig_42:45383..48431
Strand+
Gene length (bp)3048
Transcript length (bp)2802
Coding sequence length (bp)2802
Protein length (aa) 934

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01268 FTHFS Formate--tetrahydrofolate ligase 6.8E-245 306 933
PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain 1.6E-65 121 283
PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain 1.1E-27 6 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WZJ7|C1TC_SCHPO C-1-tetrahydrofolate synthase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC839.16 PE=3 SV=1 2 932 0.0E+00
sp|P09440|C1TM_YEAST C-1-tetrahydrofolate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIS1 PE=1 SV=1 6 933 0.0E+00
sp|P07245|C1TC_YEAST C-1-tetrahydrofolate synthase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE3 PE=1 SV=1 1 933 0.0E+00
sp|O43007|C1TM_SCHPO C-1-tetrahydrofolate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade9 PE=3 SV=3 3 932 0.0E+00
sp|P27653|C1TC_RAT C-1-tetrahydrofolate synthase, cytoplasmic OS=Rattus norvegicus GN=Mthfd1 PE=1 SV=3 6 933 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WZJ7|C1TC_SCHPO C-1-tetrahydrofolate synthase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC839.16 PE=3 SV=1 2 932 0.0E+00
sp|P09440|C1TM_YEAST C-1-tetrahydrofolate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIS1 PE=1 SV=1 6 933 0.0E+00
sp|P07245|C1TC_YEAST C-1-tetrahydrofolate synthase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE3 PE=1 SV=1 1 933 0.0E+00
sp|O43007|C1TM_SCHPO C-1-tetrahydrofolate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade9 PE=3 SV=3 3 932 0.0E+00
sp|P27653|C1TC_RAT C-1-tetrahydrofolate synthase, cytoplasmic OS=Rattus norvegicus GN=Mthfd1 PE=1 SV=3 6 933 0.0E+00
sp|Q922D8|C1TC_MOUSE C-1-tetrahydrofolate synthase, cytoplasmic OS=Mus musculus GN=Mthfd1 PE=1 SV=4 6 933 0.0E+00
sp|P11586|C1TC_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens GN=MTHFD1 PE=1 SV=3 6 933 0.0E+00
sp|Q5R8P0|C1TC_PONAB C-1-tetrahydrofolate synthase, cytoplasmic OS=Pongo abelii GN=MTHFD1 PE=2 SV=3 6 933 0.0E+00
sp|O96553|C1TC_DROME C-1-tetrahydrofolate synthase, cytoplasmic OS=Drosophila melanogaster GN=pug PE=1 SV=4 3 933 0.0E+00
sp|Q27772|C1TC_SPOFR C-1-tetrahydrofolate synthase, cytoplasmic OS=Spodoptera frugiperda PE=2 SV=3 44 933 0.0E+00
sp|Q0VCR7|C1TM_BOVIN Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Bos taurus GN=MTHFD1L PE=2 SV=2 16 933 0.0E+00
sp|Q6UB35|C1TM_HUMAN Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens GN=MTHFD1L PE=1 SV=1 16 933 0.0E+00
sp|Q3V3R1|C1TM_MOUSE Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Mus musculus GN=Mthfd1l PE=1 SV=2 27 933 0.0E+00
sp|P28723|FTHS_SPIOL Formate--tetrahydrofolate ligase OS=Spinacia oleracea PE=1 SV=3 298 932 0.0E+00
sp|Q9SPK5|FTHS_ARATH Formate--tetrahydrofolate ligase OS=Arabidopsis thaliana GN=THFS PE=2 SV=1 298 932 0.0E+00
sp|A5UPV2|FTHS_ROSS1 Formate--tetrahydrofolate ligase OS=Roseiflexus sp. (strain RS-1) GN=fhs PE=3 SV=1 306 923 7.0E-179
sp|A7NGQ9|FTHS_ROSCS Formate--tetrahydrofolate ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=fhs PE=3 SV=1 306 923 3.0E-174
sp|A8MIN1|FTHS_ALKOO Formate--tetrahydrofolate ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=fhs PE=3 SV=1 304 933 1.0E-171
sp|A4FL80|FTHS_SACEN Formate--tetrahydrofolate ligase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=fhs PE=3 SV=1 304 932 2.0E-170
sp|A4J0S6|FTHS_DESRM Formate--tetrahydrofolate ligase OS=Desulfotomaculum reducens (strain MI-1) GN=fhs PE=3 SV=1 304 933 1.0E-167
sp|Q6ABS5|FTHS_PROAC Formate--tetrahydrofolate ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=fhs PE=3 SV=2 306 933 1.0E-166
sp|A9B4H8|FTHS_HERA2 Formate--tetrahydrofolate ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=fhs PE=3 SV=1 310 933 9.0E-166
sp|Q3Z8K3|FTHS_DEHM1 Formate--tetrahydrofolate ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=fhs1 PE=3 SV=1 313 933 1.0E-165
sp|Q3ZX40|FTHS_DEHMC Formate--tetrahydrofolate ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=fhs PE=3 SV=1 298 933 2.0E-165
sp|B7VSJ2|FTHS_VIBTL Formate--tetrahydrofolate ligase OS=Vibrio tasmaniensis (strain LGP32) GN=fhs PE=3 SV=1 306 932 2.0E-165
sp|A3QA17|FTHS_SHELP Formate--tetrahydrofolate ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fhs PE=3 SV=1 306 932 3.0E-165
sp|Q2RM91|FTHS_MOOTA Formate--tetrahydrofolate ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=fhs PE=1 SV=1 304 933 8.0E-163
sp|Q251P8|FTHS1_DESHY Formate--tetrahydrofolate ligase 1 OS=Desulfitobacterium hafniense (strain Y51) GN=fhs1 PE=3 SV=1 304 933 3.0E-161
sp|A7N5E9|FTHS_VIBCB Formate--tetrahydrofolate ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fhs PE=3 SV=1 306 932 9.0E-161
sp|P21164|FTHS_MOOTH Formate--tetrahydrofolate ligase OS=Moorella thermoacetica GN=fhs PE=1 SV=1 304 933 5.0E-160
sp|Q8EJA7|FTHS_SHEON Formate--tetrahydrofolate ligase OS=Shewanella oneidensis (strain MR-1) GN=fhs PE=3 SV=1 306 932 5.0E-160
sp|B0TBP1|FTHS_HELMI Formate--tetrahydrofolate ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=fhs PE=3 SV=1 306 933 8.0E-160
sp|A4SPE5|FTHS_AERS4 Formate--tetrahydrofolate ligase OS=Aeromonas salmonicida (strain A449) GN=fhs PE=3 SV=1 306 932 2.0E-159
sp|B0TVP3|FTHS_SHEHH Formate--tetrahydrofolate ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=fhs PE=3 SV=1 306 932 5.0E-159
sp|B8CI99|FTHS_SHEPW Formate--tetrahydrofolate ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=fhs PE=3 SV=1 306 919 6.0E-159
sp|A8H8Z4|FTHS_SHEPA Formate--tetrahydrofolate ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=fhs PE=3 SV=1 306 932 2.0E-158
sp|B9LKW0|FTHS_CHLSY Formate--tetrahydrofolate ligase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=fhs PE=3 SV=1 310 933 2.0E-158
sp|A9WIW3|FTHS_CHLAA Formate--tetrahydrofolate ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=fhs PE=3 SV=1 310 933 2.0E-158
sp|A0KSN0|FTHS_SHESA Formate--tetrahydrofolate ligase OS=Shewanella sp. (strain ANA-3) GN=fhs PE=3 SV=1 306 932 2.0E-158
sp|A0KIN9|FTHS_AERHH Formate--tetrahydrofolate ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fhs PE=3 SV=1 306 932 3.0E-158
sp|B1KJC0|FTHS_SHEWM Formate--tetrahydrofolate ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=fhs PE=3 SV=1 306 923 5.0E-158
sp|Q07064|FTHS_CLOCY Formate--tetrahydrofolate ligase OS=Clostridium cylindrosporum GN=fhs PE=3 SV=1 304 932 1.0E-157
sp|Q0AX38|FTHS_SYNWW Formate--tetrahydrofolate ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=fhs PE=3 SV=1 304 933 1.0E-157
sp|Q0HMS6|FTHS_SHESM Formate--tetrahydrofolate ligase OS=Shewanella sp. (strain MR-4) GN=fhs PE=3 SV=1 306 932 1.0E-157
sp|C4ZBG8|FTHS_EUBR3 Formate--tetrahydrofolate ligase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=fhs PE=3 SV=1 304 933 2.0E-157
sp|Q0HR05|FTHS_SHESR Formate--tetrahydrofolate ligase OS=Shewanella sp. (strain MR-7) GN=fhs PE=3 SV=1 306 932 3.0E-157
sp|Q5XZD9|FTHS_EUBAC Formate--tetrahydrofolate ligase OS=Eubacterium acidaminophilum GN=fhs PE=3 SV=1 306 933 3.0E-157
sp|C0QAX9|FTHS_DESAH Formate--tetrahydrofolate ligase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=fhs PE=3 SV=1 319 933 4.0E-157
sp|Q7MEE8|FTHS_VIBVY Formate--tetrahydrofolate ligase OS=Vibrio vulnificus (strain YJ016) GN=fhs PE=3 SV=1 306 932 1.0E-156
sp|Q8D7D8|FTHS_VIBVU Formate--tetrahydrofolate ligase OS=Vibrio vulnificus (strain CMCP6) GN=fhs PE=3 SV=2 306 932 1.0E-156
sp|A8FQV1|FTHS_SHESH Formate--tetrahydrofolate ligase OS=Shewanella sediminis (strain HAW-EB3) GN=fhs PE=3 SV=1 306 923 3.0E-156
sp|B1M0D1|FTHS_METRJ Formate--tetrahydrofolate ligase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=fhs PE=3 SV=1 304 933 3.0E-156
sp|B5FG96|FTHS_VIBFM Formate--tetrahydrofolate ligase OS=Vibrio fischeri (strain MJ11) GN=fhs PE=3 SV=1 306 923 4.0E-156
sp|Q5E3V8|FTHS_VIBF1 Formate--tetrahydrofolate ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fhs PE=3 SV=1 306 923 7.0E-156
sp|B8ECE1|FTHS_SHEB2 Formate--tetrahydrofolate ligase OS=Shewanella baltica (strain OS223) GN=fhs PE=3 SV=1 306 932 7.0E-156
sp|A3CZY6|FTHS_SHEB5 Formate--tetrahydrofolate ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fhs PE=3 SV=1 306 932 2.0E-155
sp|B8J0C2|FTHS_DESDA Formate--tetrahydrofolate ligase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=fhs PE=3 SV=1 309 933 3.0E-155
sp|B8GC03|FTHS_CHLAD Formate--tetrahydrofolate ligase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=fhs PE=3 SV=1 310 933 3.0E-155
sp|Q87HX2|FTHS_VIBPA Formate--tetrahydrofolate ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fhs PE=3 SV=1 306 923 4.0E-155
sp|P13419|FTHS_CLOAC Formate--tetrahydrofolate ligase OS=Clostridium acidurici GN=fhs PE=3 SV=1 304 933 1.0E-154
sp|A9L3Z6|FTHS_SHEB9 Formate--tetrahydrofolate ligase OS=Shewanella baltica (strain OS195) GN=fhs PE=3 SV=1 306 932 1.0E-154
sp|A6WSY9|FTHS_SHEB8 Formate--tetrahydrofolate ligase OS=Shewanella baltica (strain OS185) GN=fhs PE=3 SV=1 306 932 2.0E-154
sp|Q6AL19|FTHS_DESPS Formate--tetrahydrofolate ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=fhs PE=3 SV=1 332 933 3.0E-154
sp|B1ZJ88|FTHS_METPB Formate--tetrahydrofolate ligase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=fhs PE=3 SV=1 304 933 3.0E-154
sp|Q83WS0|FTHS_METEA Formate--tetrahydrofolate ligase OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=fhs PE=1 SV=3 304 933 4.0E-154
sp|C4Z1V6|FTHS_EUBE2 Formate--tetrahydrofolate ligase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=fhs PE=3 SV=1 304 933 4.0E-154
sp|A9VZT0|FTHS_METEP Formate--tetrahydrofolate ligase OS=Methylobacterium extorquens (strain PA1) GN=fhs PE=3 SV=1 304 933 2.0E-153
sp|Q1MDG4|FTHS_RHIL3 Formate--tetrahydrofolate ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=fhs PE=3 SV=1 304 933 2.0E-153
sp|B7L0A5|FTHS_METC4 Formate--tetrahydrofolate ligase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=fhs PE=3 SV=1 304 933 2.0E-153
sp|B3PV59|FTHS_RHIE6 Formate--tetrahydrofolate ligase OS=Rhizobium etli (strain CIAT 652) GN=fhs PE=3 SV=1 304 933 4.0E-153
sp|Q92N42|FTHS_RHIME Formate--tetrahydrofolate ligase OS=Rhizobium meliloti (strain 1021) GN=fhs PE=3 SV=2 304 933 5.0E-152
sp|A1B1M8|FTHS_PARDP Formate--tetrahydrofolate ligase OS=Paracoccus denitrificans (strain Pd 1222) GN=fhs1 PE=3 SV=1 306 933 8.0E-152
sp|Q2K5P2|FTHS_RHIEC Formate--tetrahydrofolate ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=fhs PE=3 SV=1 304 933 9.0E-152
sp|B0UQF5|FTHS_METS4 Formate--tetrahydrofolate ligase OS=Methylobacterium sp. (strain 4-46) GN=fhs PE=3 SV=1 304 933 9.0E-152
sp|Q1AXZ4|FTHS1_RUBXD Formate--tetrahydrofolate ligase 1 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=fhs1 PE=3 SV=1 306 933 9.0E-152
sp|A2SS72|FTHS_METLZ Formate--tetrahydrofolate ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=fhs PE=3 SV=1 306 933 1.0E-151
sp|Q6LNJ0|FTHS_PHOPR Formate--tetrahydrofolate ligase OS=Photobacterium profundum GN=fhs PE=3 SV=1 306 932 2.0E-151
sp|Q1AVP8|FTHS2_RUBXD Formate--tetrahydrofolate ligase 2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=fhs2 PE=3 SV=1 306 933 2.0E-151
sp|A6UBV0|FTHS_SINMW Formate--tetrahydrofolate ligase OS=Sinorhizobium medicae (strain WSM419) GN=fhs PE=3 SV=1 304 933 2.0E-151
sp|Q1AT39|FTHS3_RUBXD Formate--tetrahydrofolate ligase 3 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=fhs3 PE=3 SV=1 318 933 3.0E-151
sp|B9IYP4|FTHS_BACCQ Formate--tetrahydrofolate ligase OS=Bacillus cereus (strain Q1) GN=fhs PE=3 SV=1 304 933 3.0E-151
sp|B5ZYA2|FTHS_RHILW Formate--tetrahydrofolate ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=fhs PE=3 SV=1 304 933 4.0E-151
sp|A1RFN3|FTHS_SHESW Formate--tetrahydrofolate ligase OS=Shewanella sp. (strain W3-18-1) GN=fhs PE=3 SV=1 306 932 5.0E-151
sp|A4YAP3|FTHS_SHEPC Formate--tetrahydrofolate ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fhs PE=3 SV=1 306 932 7.0E-151
sp|Q67JH9|FTHS_SYMTH Formate--tetrahydrofolate ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=fhs PE=3 SV=1 306 933 7.0E-151
sp|B9JZN5|FTHS_AGRVS Formate--tetrahydrofolate ligase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=fhs PE=3 SV=1 306 933 9.0E-151
sp|B7HP29|FTHS_BACC7 Formate--tetrahydrofolate ligase OS=Bacillus cereus (strain AH187) GN=fhs PE=3 SV=1 304 933 9.0E-151
sp|Q6HJK9|FTHS_BACHK Formate--tetrahydrofolate ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=fhs PE=3 SV=1 304 933 1.0E-150
sp|Q63C61|FTHS_BACCZ Formate--tetrahydrofolate ligase OS=Bacillus cereus (strain ZK / E33L) GN=fhs PE=3 SV=1 304 933 1.0E-150
sp|C1ES77|FTHS_BACC3 Formate--tetrahydrofolate ligase OS=Bacillus cereus (strain 03BB102) GN=fhs PE=3 SV=1 304 933 1.0E-150
sp|A0RD97|FTHS_BACAH Formate--tetrahydrofolate ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=fhs PE=3 SV=2 304 933 1.0E-150
sp|A8LIR1|FTHS_DINSH Formate--tetrahydrofolate ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=fhs PE=3 SV=1 306 933 2.0E-150
sp|B7JLG8|FTHS_BACC0 Formate--tetrahydrofolate ligase OS=Bacillus cereus (strain AH820) GN=fhs PE=3 SV=1 304 933 2.0E-150
sp|Q81RE1|FTHS_BACAN Formate--tetrahydrofolate ligase OS=Bacillus anthracis GN=fhs PE=3 SV=1 304 933 2.0E-150
sp|C3LKJ6|FTHS_BACAC Formate--tetrahydrofolate ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=fhs PE=3 SV=1 304 933 2.0E-150
sp|C3P858|FTHS_BACAA Formate--tetrahydrofolate ligase OS=Bacillus anthracis (strain A0248) GN=fhs PE=3 SV=1 304 933 2.0E-150
sp|Q739F4|FTHS_BACC1 Formate--tetrahydrofolate ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=fhs PE=3 SV=1 304 933 3.0E-150
sp|B8IBS4|FTHS_METNO Formate--tetrahydrofolate ligase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=fhs PE=3 SV=1 304 933 6.0E-150
sp|Q1MPZ9|FTHS_LAWIP Formate--tetrahydrofolate ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=fhs PE=3 SV=1 313 933 1.0E-149
sp|B7IUA4|FTHS_BACC2 Formate--tetrahydrofolate ligase OS=Bacillus cereus (strain G9842) GN=fhs PE=3 SV=1 304 933 3.0E-149
sp|B9KLK4|FTHS_RHOSK Formate--tetrahydrofolate ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=fhs PE=3 SV=1 304 933 4.0E-149
sp|Q3J047|FTHS_RHOS4 Formate--tetrahydrofolate ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=fhs PE=3 SV=1 304 933 5.0E-149
sp|A3PM52|FTHS_RHOS1 Formate--tetrahydrofolate ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=fhs PE=3 SV=1 304 933 5.0E-149
sp|B9J7E8|FTHS_AGRRK Formate--tetrahydrofolate ligase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=fhs PE=3 SV=1 304 933 6.0E-149
sp|Q81E87|FTHS_BACCR Formate--tetrahydrofolate ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=fhs PE=3 SV=1 304 933 9.0E-149
sp|Q5LNV0|FTHS_RUEPO Formate--tetrahydrofolate ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=fhs1 PE=3 SV=1 306 933 1.0E-147
sp|Q11G79|FTHS_CHESB Formate--tetrahydrofolate ligase OS=Chelativorans sp. (strain BNC1) GN=fhs PE=3 SV=1 304 933 1.0E-147
sp|Q4FL49|FTHS_PELUB Formate--tetrahydrofolate ligase OS=Pelagibacter ubique (strain HTCC1062) GN=fhs PE=3 SV=1 304 933 2.0E-147
sp|O66164|FTHS_SPHPI Formate--tetrahydrofolate ligase OS=Sphingomonas paucimobilis GN=fhs PE=3 SV=1 306 933 2.0E-147
sp|Q160C2|FTHS_ROSDO Formate--tetrahydrofolate ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=fhs PE=3 SV=1 306 933 3.0E-147
sp|A8FEC9|FTHS_BACP2 Formate--tetrahydrofolate ligase OS=Bacillus pumilus (strain SAFR-032) GN=fhs PE=3 SV=1 306 933 6.0E-147
sp|Q891R3|FTHS_CLOTE Formate--tetrahydrofolate ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=fhs PE=3 SV=1 302 933 1.0E-146
sp|A9IM41|FTHS_BART1 Formate--tetrahydrofolate ligase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=fhs PE=3 SV=1 306 923 3.0E-146
sp|A4WQ11|FTHS_RHOS5 Formate--tetrahydrofolate ligase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=fhs PE=3 SV=1 306 933 7.0E-146
sp|A9KNJ5|FTHS_CLOPH Formate--tetrahydrofolate ligase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=fhs PE=3 SV=1 304 933 5.0E-145
sp|A2RLK1|FTHS_LACLM Formate--tetrahydrofolate ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=fhs PE=3 SV=1 306 933 1.0E-144
sp|Q02ZS7|FTHS_LACLS Formate--tetrahydrofolate ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=fhs PE=3 SV=1 306 933 2.0E-144
sp|C0QX38|FTHS_BRAHW Formate--tetrahydrofolate ligase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=fhs PE=3 SV=1 304 933 2.0E-144
sp|Q28TR4|FTHS_JANSC Formate--tetrahydrofolate ligase OS=Jannaschia sp. (strain CCS1) GN=fhs PE=3 SV=1 306 933 3.0E-144
sp|A1JMA3|FTHS_YERE8 Formate--tetrahydrofolate ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fhs PE=3 SV=2 302 923 2.0E-143
sp|A5G276|FTHS_ACICJ Formate--tetrahydrofolate ligase OS=Acidiphilium cryptum (strain JF-5) GN=fhs PE=3 SV=1 306 933 2.0E-143
sp|B5YJE1|FTHS_THEYD Formate--tetrahydrofolate ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=fhs PE=3 SV=1 293 932 4.0E-143
sp|Q9CH07|FTHS_LACLA Formate--tetrahydrofolate ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=fhs PE=3 SV=1 306 933 4.0E-143
sp|Q834D6|FTHS_ENTFA Formate--tetrahydrofolate ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=fhs PE=3 SV=1 306 933 4.0E-143
sp|Q0APT3|FTHS_MARMM Formate--tetrahydrofolate ligase OS=Maricaulis maris (strain MCS10) GN=fhs PE=3 SV=1 306 933 5.0E-143
sp|C3MFQ8|FTHS_RHISN Formate--tetrahydrofolate ligase OS=Rhizobium sp. (strain NGR234) GN=fhs PE=3 SV=1 304 933 1.0E-142
sp|A2SKX8|FTHS_METPP Formate--tetrahydrofolate ligase OS=Methylibium petroleiphilum (strain PM1) GN=fhs PE=3 SV=1 306 933 2.0E-142
sp|Q7VLW6|FTHS_HAEDU Formate--tetrahydrofolate ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=fhs PE=3 SV=1 304 933 2.0E-142
sp|B0S0G1|FTHS_FINM2 Formate--tetrahydrofolate ligase OS=Finegoldia magna (strain ATCC 29328) GN=fhs PE=3 SV=1 306 933 3.0E-142
sp|B2IC30|FTHS_BEII9 Formate--tetrahydrofolate ligase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=fhs PE=3 SV=1 306 933 3.0E-142
sp|Q9KLX7|FTHS_VIBCH Formate--tetrahydrofolate ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fhs PE=3 SV=2 307 932 4.0E-142
sp|Q3A9K2|FTHS_CARHZ Formate--tetrahydrofolate ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=fhs PE=3 SV=1 306 933 4.0E-142
sp|Q98HQ4|FTHS_RHILO Formate--tetrahydrofolate ligase OS=Rhizobium loti (strain MAFF303099) GN=fhs PE=3 SV=1 304 933 7.0E-142
sp|Q24ZZ8|FTHS2_DESHY Formate--tetrahydrofolate ligase 2 OS=Desulfitobacterium hafniense (strain Y51) GN=fhs2 PE=3 SV=1 306 933 4.0E-141
sp|A1SAE2|FTHS_SHEAM Formate--tetrahydrofolate ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fhs PE=3 SV=1 306 932 5.0E-141
sp|Q0BX04|FTHS_HYPNA Formate--tetrahydrofolate ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=fhs PE=3 SV=1 306 932 7.0E-141
sp|Q92AD2|FTHS_LISIN Formate--tetrahydrofolate ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=fhs PE=3 SV=1 300 933 9.0E-141
sp|B6EIJ9|FTHS_ALISL Formate--tetrahydrofolate ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=fhs PE=3 SV=1 306 932 1.0E-140
sp|B2A3Q6|FTHS_NATTJ Formate--tetrahydrofolate ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=fhs PE=3 SV=1 304 933 3.0E-140
sp|Q1GE26|FTHS_RUEST Formate--tetrahydrofolate ligase OS=Ruegeria sp. (strain TM1040) GN=fhs PE=3 SV=1 306 933 5.0E-140
sp|B4ET09|FTHS_PROMH Formate--tetrahydrofolate ligase OS=Proteus mirabilis (strain HI4320) GN=fhs PE=3 SV=1 304 933 1.0E-139
sp|B3GX43|FTHS_ACTP7 Formate--tetrahydrofolate ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=fhs PE=3 SV=1 304 933 4.0E-139
sp|A3MZI4|FTHS_ACTP2 Formate--tetrahydrofolate ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=fhs PE=3 SV=1 304 933 4.0E-139
sp|A0LLR3|FTHS_SYNFM Formate--tetrahydrofolate ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=fhs PE=3 SV=1 307 933 6.0E-139
sp|Q605Q9|FTHS_METCA Formate--tetrahydrofolate ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=fhs PE=3 SV=1 306 933 7.0E-139
sp|A5ILJ8|FTHS_THEP1 Formate--tetrahydrofolate ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=fhs PE=3 SV=1 317 923 1.0E-138
sp|C5CI89|FTHS_KOSOT Formate--tetrahydrofolate ligase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=fhs PE=3 SV=1 307 933 4.0E-138
sp|Q9X287|FTHS_THEMA Formate--tetrahydrofolate ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fhs PE=1 SV=1 317 923 5.0E-138
sp|B1LAQ7|FTHS_THESQ Formate--tetrahydrofolate ligase OS=Thermotoga sp. (strain RQ2) GN=fhs PE=3 SV=1 317 923 2.0E-137
sp|Q1WTW0|FTHS_LACS1 Formate--tetrahydrofolate ligase OS=Lactobacillus salivarius (strain UCC118) GN=fhs PE=3 SV=1 306 933 2.0E-137
sp|Q0BW57|FTHS_GRABC Formate--tetrahydrofolate ligase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=fhs PE=3 SV=1 306 933 2.0E-137
sp|Q8CNV9|FTHS_STAES Formate--tetrahydrofolate ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fhs PE=3 SV=1 306 933 3.0E-137
sp|Q5HNH4|FTHS_STAEQ Formate--tetrahydrofolate ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fhs PE=3 SV=1 306 933 3.0E-137
sp|Q4L776|FTHS_STAHJ Formate--tetrahydrofolate ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=fhs PE=3 SV=1 306 933 3.0E-137
sp|A7HLZ4|FTHS_FERNB Formate--tetrahydrofolate ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=fhs PE=3 SV=1 306 933 8.0E-137
sp|A3DI22|FTHS_CLOTH Formate--tetrahydrofolate ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=fhs PE=3 SV=1 306 933 8.0E-137
sp|Q03YB1|FTHS_LEUMM Formate--tetrahydrofolate ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=fhs PE=3 SV=1 306 933 9.0E-137
sp|B8FGU7|FTHS_DESAA Formate--tetrahydrofolate ligase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=fhs PE=3 SV=1 308 933 1.0E-136
sp|B7IG29|FTHS_THEAB Formate--tetrahydrofolate ligase OS=Thermosipho africanus (strain TCF52B) GN=fhs PE=3 SV=1 304 932 1.0E-136
sp|A9BIV8|FTHS_PETMO Formate--tetrahydrofolate ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=fhs PE=3 SV=1 306 932 2.0E-136
sp|Q5HF42|FTHS_STAAC Formate--tetrahydrofolate ligase OS=Staphylococcus aureus (strain COL) GN=fhs PE=3 SV=2 306 933 9.0E-136
sp|A8Z2Q0|FTHS_STAAT Formate--tetrahydrofolate ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=fhs PE=3 SV=2 306 933 9.0E-136
sp|A6QHR5|FTHS_STAAE Formate--tetrahydrofolate ligase OS=Staphylococcus aureus (strain Newman) GN=fhs PE=3 SV=1 306 933 9.0E-136
sp|Q2FG06|FTHS_STAA3 Formate--tetrahydrofolate ligase OS=Staphylococcus aureus (strain USA300) GN=fhs PE=3 SV=1 306 933 9.0E-136
sp|Q8NW37|FTHS_STAAW Formate--tetrahydrofolate ligase OS=Staphylococcus aureus (strain MW2) GN=fhs PE=3 SV=1 306 933 1.0E-135
sp|Q6G8J5|FTHS_STAAS Formate--tetrahydrofolate ligase OS=Staphylococcus aureus (strain MSSA476) GN=fhs PE=3 SV=1 306 933 1.0E-135
sp|Q6GFX6|FTHS_STAAR Formate--tetrahydrofolate ligase OS=Staphylococcus aureus (strain MRSA252) GN=fhs PE=3 SV=1 306 933 1.0E-135
sp|Q2G296|FTHS_STAA8 Formate--tetrahydrofolate ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=fhs PE=3 SV=1 306 933 1.0E-135
sp|Q5NQC7|FTHS_ZYMMO Formate--tetrahydrofolate ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=fhs PE=3 SV=3 306 923 3.0E-135
sp|P0DF93|FTHS2_STRPQ Formate--tetrahydrofolate ligase 2 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=fhs2 PE=3 SV=1 304 933 5.0E-135
sp|P0DF92|FTHS2_STRP3 Formate--tetrahydrofolate ligase 2 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=fhs2 PE=3 SV=1 304 933 5.0E-135
sp|B8EKB9|FTHS_METSB Formate--tetrahydrofolate ligase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=fhs PE=3 SV=1 306 933 5.0E-135
sp|Q2YTF6|FTHS_STAAB Formate--tetrahydrofolate ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=fhs PE=3 SV=1 306 933 5.0E-135
sp|Q99XR2|FTHS2_STRP1 Formate--tetrahydrofolate ligase 2 OS=Streptococcus pyogenes serotype M1 GN=fhs2 PE=3 SV=1 304 933 8.0E-135
sp|Q97EB3|FTHS_CLOAB Formate--tetrahydrofolate ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=fhs PE=3 SV=1 304 933 1.0E-134
sp|B8DDM6|FTHS_LISMH Formate--tetrahydrofolate ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=fhs PE=3 SV=1 300 933 1.0E-134
sp|Q5X9K7|FTHS2_STRP6 Formate--tetrahydrofolate ligase 2 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=fhs2 PE=3 SV=1 304 933 2.0E-134
sp|Q8RHF4|FTHS_FUSNN Formate--tetrahydrofolate ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=fhs PE=3 SV=1 306 933 2.0E-134
sp|Q71YD9|FTHS_LISMF Formate--tetrahydrofolate ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=fhs PE=3 SV=1 300 933 3.0E-134
sp|C1KWH6|FTHS_LISMC Formate--tetrahydrofolate ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=fhs PE=3 SV=1 300 933 3.0E-134
sp|A2RGS2|FTHS2_STRPG Formate--tetrahydrofolate ligase 2 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=fhs2 PE=3 SV=1 304 933 4.0E-134
sp|Q1JJK1|FTHS2_STRPC Formate--tetrahydrofolate ligase 2 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=fhs2 PE=3 SV=1 304 933 4.0E-134
sp|Q1J9F2|FTHS2_STRPB Formate--tetrahydrofolate ligase 2 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=fhs2 PE=3 SV=1 304 933 4.0E-134
sp|Q7A535|FTHS_STAAN Formate--tetrahydrofolate ligase OS=Staphylococcus aureus (strain N315) GN=fhs PE=1 SV=1 306 933 5.0E-134
sp|Q99TD2|FTHS_STAAM Formate--tetrahydrofolate ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fhs PE=3 SV=1 306 933 5.0E-134
sp|A5ITQ4|FTHS_STAA9 Formate--tetrahydrofolate ligase OS=Staphylococcus aureus (strain JH9) GN=fhs PE=3 SV=1 306 933 5.0E-134
sp|A6U2J8|FTHS_STAA2 Formate--tetrahydrofolate ligase OS=Staphylococcus aureus (strain JH1) GN=fhs PE=3 SV=1 306 933 5.0E-134
sp|A7X3G5|FTHS_STAA1 Formate--tetrahydrofolate ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=fhs PE=3 SV=1 306 933 5.0E-134
sp|B0KC36|FTHS_THEP3 Formate--tetrahydrofolate ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=fhs PE=3 SV=1 304 933 7.0E-134
sp|Q8A9S8|FTHS_BACTN Formate--tetrahydrofolate ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=fhs PE=3 SV=1 304 932 8.0E-134
sp|Q8R7L3|FTHS_CALS4 Formate--tetrahydrofolate ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=fhs PE=3 SV=1 304 933 8.0E-134
sp|B1MY45|FTHS_LEUCK Formate--tetrahydrofolate ligase OS=Leuconostoc citreum (strain KM20) GN=fhs PE=3 SV=1 306 933 9.0E-134
sp|Q8Y624|FTHS_LISMO Formate--tetrahydrofolate ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=fhs PE=3 SV=2 300 933 2.0E-133
sp|Q1JEK4|FTHS2_STRPD Formate--tetrahydrofolate ligase 2 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=fhs2 PE=3 SV=1 304 933 2.0E-133
sp|Q48QZ2|FTHS2_STRPM Formate--tetrahydrofolate ligase 2 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=fhs2 PE=3 SV=1 304 933 2.0E-133
sp|B0K5A5|FTHS_THEPX Formate--tetrahydrofolate ligase OS=Thermoanaerobacter sp. (strain X514) GN=fhs PE=3 SV=1 304 933 2.0E-133
sp|A8ZZJ0|FTHS_DESOH Formate--tetrahydrofolate ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=fhs PE=3 SV=1 306 933 3.0E-133
sp|A6LJS5|FTHS_THEM4 Formate--tetrahydrofolate ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=fhs PE=3 SV=1 304 932 3.0E-133
sp|A7GJB8|FTHS_CLOBL Formate--tetrahydrofolate ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=fhs PE=3 SV=1 306 933 1.0E-132
sp|B1IGY1|FTHS_CLOBK Formate--tetrahydrofolate ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=fhs PE=3 SV=1 306 933 1.0E-132
sp|B9DN77|FTHS_STACT Formate--tetrahydrofolate ligase OS=Staphylococcus carnosus (strain TM300) GN=fhs PE=3 SV=1 306 933 1.0E-132
sp|Q8NZ49|FTHS2_STRP8 Formate--tetrahydrofolate ligase 2 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=fhs2 PE=3 SV=1 304 933 1.0E-132
sp|A0JZ10|FTHS_ARTS2 Formate--tetrahydrofolate ligase OS=Arthrobacter sp. (strain FB24) GN=fhs PE=3 SV=1 304 933 2.0E-132
sp|C3KVU4|FTHS_CLOB6 Formate--tetrahydrofolate ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=fhs PE=3 SV=1 306 933 2.0E-132
sp|A5I7P9|FTHS_CLOBH Formate--tetrahydrofolate ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=fhs PE=3 SV=1 306 933 2.0E-132
sp|A7FZB0|FTHS_CLOB1 Formate--tetrahydrofolate ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=fhs PE=3 SV=1 306 933 2.0E-132
sp|A7GZZ0|FTHS_CAMC5 Formate--tetrahydrofolate ligase OS=Campylobacter curvus (strain 525.92) GN=fhs PE=3 SV=1 306 932 2.0E-132
sp|A5WI04|FTHS_PSYWF Formate--tetrahydrofolate ligase OS=Psychrobacter sp. (strain PRwf-1) GN=fhs PE=3 SV=1 304 933 2.0E-132
sp|A9WMW3|FTHS_RENSM Formate--tetrahydrofolate ligase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=fhs PE=3 SV=1 306 924 4.0E-132
sp|Q1J4C0|FTHS2_STRPF Formate--tetrahydrofolate ligase 2 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=fhs2 PE=3 SV=1 304 933 6.0E-132
sp|Q64U80|FTHS_BACFR Formate--tetrahydrofolate ligase OS=Bacteroides fragilis (strain YCH46) GN=fhs PE=3 SV=1 304 932 6.0E-132
sp|Q5LD60|FTHS_BACFN Formate--tetrahydrofolate ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=fhs PE=3 SV=1 304 932 6.0E-132
sp|A0PXN0|FTHS_CLONN Formate--tetrahydrofolate ligase OS=Clostridium novyi (strain NT) GN=fhs PE=3 SV=1 304 933 7.0E-132
sp|B8D067|FTHS_HALOH Formate--tetrahydrofolate ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=fhs PE=3 SV=1 306 933 7.0E-132
sp|A0AJY2|FTHS_LISW6 Formate--tetrahydrofolate ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=fhs PE=3 SV=1 300 933 8.0E-132
sp|B2KDK9|FTHS_ELUMP Formate--tetrahydrofolate ligase OS=Elusimicrobium minutum (strain Pei191) GN=fhs PE=3 SV=1 306 932 1.0E-131
sp|A3CL27|FTHS1_STRSV Formate--tetrahydrofolate ligase 1 OS=Streptococcus sanguinis (strain SK36) GN=fhs1 PE=3 SV=2 304 933 2.0E-131
sp|C1FND0|FTHS_CLOBJ Formate--tetrahydrofolate ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=fhs PE=3 SV=1 306 933 4.0E-131
sp|B8I3S9|FTHS_CLOCE Formate--tetrahydrofolate ligase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=fhs PE=3 SV=1 306 933 4.0E-131
sp|B2GF64|FTHS_LACF3 Formate--tetrahydrofolate ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=fhs PE=3 SV=1 306 933 7.0E-131
sp|Q88W76|FTHS_LACPL Formate--tetrahydrofolate ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=fhs PE=3 SV=1 307 933 9.0E-131
sp|Q1GZ16|FTHS_METFK Formate--tetrahydrofolate ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=fhs PE=3 SV=1 306 933 1.0E-130
sp|Q0SQ82|FTHS_CLOPS Formate--tetrahydrofolate ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=fhs PE=3 SV=1 304 933 1.0E-130
sp|A6LPL1|FTHS_CLOB8 Formate--tetrahydrofolate ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=fhs PE=3 SV=1 304 933 3.0E-130
sp|Q65IA6|FTHS_BACLD Formate--tetrahydrofolate ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=fhs PE=3 SV=1 306 933 5.0E-130
sp|A1SQH3|FTHS_NOCSJ Formate--tetrahydrofolate ligase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=fhs PE=3 SV=1 306 922 2.0E-129
sp|Q8XHL4|FTHS_CLOPE Formate--tetrahydrofolate ligase OS=Clostridium perfringens (strain 13 / Type A) GN=fhs PE=3 SV=1 304 933 2.0E-129
sp|Q18JB5|FTHS_HALWD Formate--tetrahydrofolate ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=fhs PE=3 SV=1 305 912 3.0E-129
sp|Q0TMI3|FTHS_CLOP1 Formate--tetrahydrofolate ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=fhs PE=3 SV=1 304 933 4.0E-129
sp|A8Z6G1|FTHS_CAMC1 Formate--tetrahydrofolate ligase OS=Campylobacter concisus (strain 13826) GN=fhs PE=3 SV=1 306 932 4.0E-129
sp|A9M1J1|FTHS_NEIM0 Formate--tetrahydrofolate ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=fhs PE=3 SV=1 306 933 3.0E-128
sp|Q189R2|FTHS_PEPD6 Formate--tetrahydrofolate ligase OS=Peptoclostridium difficile (strain 630) GN=fhs PE=3 SV=1 306 933 3.0E-128
sp|B2UXU5|FTHS_CLOBA Formate--tetrahydrofolate ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=fhs PE=3 SV=1 304 933 8.0E-128
sp|A3CN49|FTHS2_STRSV Formate--tetrahydrofolate ligase 2 OS=Streptococcus sanguinis (strain SK36) GN=fhs2 PE=3 SV=1 306 933 1.0E-127
sp|A5N5B3|FTHS_CLOK5 Formate--tetrahydrofolate ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=fhs PE=3 SV=1 306 933 2.0E-127
sp|B9DYW1|FTHS_CLOK1 Formate--tetrahydrofolate ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=fhs PE=3 SV=1 306 933 2.0E-127
sp|Q7MUZ8|FTHS_PORGI Formate--tetrahydrofolate ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=fhs PE=3 SV=1 306 932 2.0E-127
sp|B1KTC6|FTHS_CLOBM Formate--tetrahydrofolate ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=fhs PE=3 SV=1 306 933 5.0E-127
sp|Q9JVY8|FTHS_NEIMA Formate--tetrahydrofolate ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fhs PE=3 SV=1 306 933 5.0E-127
sp|B2TI29|FTHS_CLOBB Formate--tetrahydrofolate ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=fhs PE=3 SV=1 304 933 6.0E-127
sp|Q04FS6|FTHS_OENOB Formate--tetrahydrofolate ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=fhs PE=3 SV=1 306 932 6.0E-127
sp|B9DS83|FTHS_STRU0 Formate--tetrahydrofolate ligase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=fhs PE=3 SV=1 306 933 8.0E-127
sp|Q5V5Y2|FTHS_HALMA Formate--tetrahydrofolate ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=fhs PE=3 SV=2 317 933 9.0E-127
sp|Q9JXY2|FTHS_NEIMB Formate--tetrahydrofolate ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=fhs PE=3 SV=1 306 933 2.0E-126
sp|A1KS57|FTHS_NEIMF Formate--tetrahydrofolate ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=fhs PE=3 SV=1 306 933 2.0E-126
sp|B2G5A9|FTHS_LACRJ Formate--tetrahydrofolate ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=fhs PE=3 SV=1 306 933 3.0E-124
sp|A5VHS9|FTHS_LACRD Formate--tetrahydrofolate ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=fhs PE=3 SV=1 306 933 3.0E-124
sp|A6LAR6|FTHS_PARD8 Formate--tetrahydrofolate ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=fhs PE=3 SV=1 304 932 4.0E-124
sp|B4RP08|FTHS_NEIG2 Formate--tetrahydrofolate ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=fhs PE=3 SV=1 306 933 4.0E-124
sp|Q5FAG1|FTHS_NEIG1 Formate--tetrahydrofolate ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fhs PE=3 SV=1 306 933 4.0E-124
sp|A4XIU2|FTHS_CALS8 Formate--tetrahydrofolate ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=fhs PE=3 SV=1 312 923 4.0E-123
sp|Q5FIU5|FTHS2_LACAC Formate--tetrahydrofolate ligase 2 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=fhs2 PE=3 SV=1 304 933 3.0E-122
sp|Q8E5E3|FTHS_STRA3 Formate--tetrahydrofolate ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=fhs PE=3 SV=1 306 922 2.0E-121
sp|Q3K138|FTHS_STRA1 Formate--tetrahydrofolate ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=fhs PE=3 SV=1 306 922 3.0E-121
sp|Q8DZP5|FTHS_STRA5 Formate--tetrahydrofolate ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=fhs PE=3 SV=1 306 922 4.0E-121
sp|A4VU67|FTHS_STRSY Formate--tetrahydrofolate ligase OS=Streptococcus suis (strain 05ZYH33) GN=fhs PE=3 SV=1 306 933 6.0E-121
sp|A4W0G0|FTHS_STRS2 Formate--tetrahydrofolate ligase OS=Streptococcus suis (strain 98HAH33) GN=fhs PE=3 SV=1 306 933 6.0E-121
sp|Q1DFW5|FTHS_MYXXD Formate--tetrahydrofolate ligase OS=Myxococcus xanthus (strain DK 1622) GN=fhs PE=3 SV=1 317 922 3.0E-120
sp|Q5M083|FTHS_STRT1 Formate--tetrahydrofolate ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=fhs PE=3 SV=1 306 922 3.0E-120
sp|Q5M4U2|FTHS_STRT2 Formate--tetrahydrofolate ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=fhs PE=3 SV=1 306 922 4.0E-120
sp|Q59925|FTHS_STRMU Formate--tetrahydrofolate ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=fhs PE=3 SV=2 306 933 5.0E-120
sp|A6L4P0|FTHS_BACV8 Formate--tetrahydrofolate ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=fhs PE=3 SV=1 304 932 1.0E-119
sp|Q03L41|FTHS_STRTD Formate--tetrahydrofolate ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=fhs PE=3 SV=1 306 922 2.0E-119
sp|C0M9N3|FTHS_STRE4 Formate--tetrahydrofolate ligase OS=Streptococcus equi subsp. equi (strain 4047) GN=fhs PE=3 SV=1 306 933 2.0E-119
sp|B9MM59|FTHS_CALBD Formate--tetrahydrofolate ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=fhs PE=3 SV=1 309 923 4.0E-119
sp|B4U2T6|FTHS_STREM Formate--tetrahydrofolate ligase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=fhs PE=3 SV=1 306 933 5.0E-119
sp|C0MFU5|FTHS_STRS7 Formate--tetrahydrofolate ligase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=fhs PE=3 SV=1 306 933 6.0E-119
sp|Q6NH87|FTHS_CORDI Formate--tetrahydrofolate ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=fhs PE=3 SV=1 304 933 8.0E-119
sp|Q73RR6|FTHS_TREDE Formate--tetrahydrofolate ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=fhs PE=3 SV=1 304 932 4.0E-118
sp|A8F7D5|FTHS_PSELT Formate--tetrahydrofolate ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=fhs PE=3 SV=1 306 933 5.0E-118
sp|Q2LU82|FTHS_SYNAS Formate--tetrahydrofolate ligase OS=Syntrophus aciditrophicus (strain SB) GN=fhs PE=3 SV=1 317 932 2.0E-117
sp|A1R8N9|FTHS_ARTAT Formate--tetrahydrofolate ligase OS=Arthrobacter aurescens (strain TC1) GN=fhs PE=3 SV=1 301 933 2.0E-117
sp|C1CEI6|FTHS_STRZJ Formate--tetrahydrofolate ligase OS=Streptococcus pneumoniae (strain JJA) GN=fhs PE=3 SV=1 306 933 8.0E-117
sp|C1CR74|FTHS_STRZT Formate--tetrahydrofolate ligase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=fhs PE=3 SV=1 306 933 1.0E-116
sp|Q97QI2|FTHS_STRPN Formate--tetrahydrofolate ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=fhs PE=3 SV=1 306 933 1.0E-116
sp|B1IC26|FTHS_STRPI Formate--tetrahydrofolate ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=fhs PE=3 SV=1 306 933 2.0E-116
sp|B5E4W4|FTHS_STRP4 Formate--tetrahydrofolate ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=fhs PE=3 SV=1 306 933 2.0E-116
sp|C1CKW9|FTHS_STRZP Formate--tetrahydrofolate ligase OS=Streptococcus pneumoniae (strain P1031) GN=fhs PE=3 SV=1 306 933 3.0E-116
sp|B2IPQ3|FTHS_STRPS Formate--tetrahydrofolate ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=fhs PE=3 SV=1 306 933 3.0E-116
sp|C1C7J4|FTHS_STRP7 Formate--tetrahydrofolate ligase OS=Streptococcus pneumoniae (strain 70585) GN=fhs PE=3 SV=1 306 933 3.0E-116
sp|P0DF91|FTHS1_STRPQ Formate--tetrahydrofolate ligase 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=fhs1 PE=3 SV=1 306 933 4.0E-116
sp|A2REC4|FTHS1_STRPG Formate--tetrahydrofolate ligase 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=fhs1 PE=3 SV=1 306 933 4.0E-116
sp|Q1JLK2|FTHS1_STRPC Formate--tetrahydrofolate ligase 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=fhs1 PE=3 SV=1 306 933 4.0E-116
sp|Q1JBM0|FTHS1_STRPB Formate--tetrahydrofolate ligase 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=fhs1 PE=3 SV=1 306 933 4.0E-116
sp|Q5XC12|FTHS1_STRP6 Formate--tetrahydrofolate ligase 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=fhs1 PE=1 SV=1 306 933 4.0E-116
sp|P0DF90|FTHS1_STRP3 Formate--tetrahydrofolate ligase 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=fhs1 PE=3 SV=1 306 933 4.0E-116
sp|Q99ZI9|FTHS1_STRP1 Formate--tetrahydrofolate ligase 1 OS=Streptococcus pyogenes serotype M1 GN=fhs1 PE=3 SV=1 306 933 4.0E-116
sp|Q8DPL5|FTHS_STRR6 Formate--tetrahydrofolate ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=fhs PE=3 SV=1 306 933 7.0E-116
sp|B8ZJQ0|FTHS_STRPJ Formate--tetrahydrofolate ligase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=fhs PE=3 SV=1 306 933 7.0E-116
sp|Q04K90|FTHS_STRP2 Formate--tetrahydrofolate ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=fhs PE=3 SV=1 306 933 7.0E-116
sp|Q48TE8|FTHS1_STRPM Formate--tetrahydrofolate ligase 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=fhs1 PE=3 SV=1 306 933 7.0E-116
sp|Q1JGN8|FTHS1_STRPD Formate--tetrahydrofolate ligase 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=fhs1 PE=3 SV=1 306 933 8.0E-116
sp|Q1J6F7|FTHS1_STRPF Formate--tetrahydrofolate ligase 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=fhs1 PE=3 SV=1 306 933 3.0E-115
sp|Q8P0X5|FTHS1_STRP8 Formate--tetrahydrofolate ligase 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=fhs1 PE=3 SV=1 306 933 3.0E-115
sp|Q9HI67|FTHS_THEAC Formate--tetrahydrofolate ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fhs PE=3 SV=1 317 933 2.0E-114
sp|Q4JVW2|FTHS_CORJK Formate--tetrahydrofolate ligase OS=Corynebacterium jeikeium (strain K411) GN=fhs PE=3 SV=1 302 933 9.0E-113
sp|Q72GY9|FTHS_THET2 Formate--tetrahydrofolate ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=fhs PE=3 SV=1 318 932 6.0E-112
sp|Q97CL3|FTHS_THEVO Formate--tetrahydrofolate ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fhs PE=3 SV=1 317 933 8.0E-112
sp|Q5FJY2|FTHS1_LACAC Formate--tetrahydrofolate ligase 1 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=fhs1 PE=3 SV=1 304 933 3.0E-110
sp|Q74JC1|FTHS_LACJO Formate--tetrahydrofolate ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=fhs PE=3 SV=1 304 933 2.0E-108
sp|Q03FM6|FTHS_PEDPA Formate--tetrahydrofolate ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=fhs PE=3 SV=1 306 933 1.0E-104
sp|Q1GA94|FTHS_LACDA Formate--tetrahydrofolate ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=fhs PE=3 SV=2 304 933 1.0E-103
sp|Q04AM0|FTHS_LACDB Formate--tetrahydrofolate ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=fhs PE=3 SV=1 304 933 1.0E-103
sp|Q6KZM3|FTHS_PICTO Formate--tetrahydrofolate ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fhs PE=3 SV=1 322 932 2.0E-103
sp|Q38X32|FTHS_LACSS Formate--tetrahydrofolate ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=fhs PE=3 SV=1 464 933 1.0E-101
sp|A9NE95|FTHS_ACHLI Formate--tetrahydrofolate ligase OS=Acholeplasma laidlawii (strain PG-8A) GN=fhs PE=3 SV=1 324 923 9.0E-101
sp|Q03S45|FTHS_LACBA Formate--tetrahydrofolate ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=fhs PE=3 SV=1 464 933 3.0E-98
sp|Q038Y4|FTHS_LACC3 Formate--tetrahydrofolate ligase OS=Lactobacillus casei (strain ATCC 334) GN=fhs PE=3 SV=1 464 933 1.0E-97
sp|B3WEG3|FTHS_LACCB Formate--tetrahydrofolate ligase OS=Lactobacillus casei (strain BL23) GN=fhs PE=3 SV=1 464 933 1.0E-97
sp|Q043I0|FTHS_LACGA Formate--tetrahydrofolate ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=fhs PE=3 SV=1 304 933 2.0E-94
sp|Q9LHH7|FOLD2_ARATH Bifunctional protein FolD 2 OS=Arabidopsis thaliana GN=FOLD2 PE=2 SV=1 3 285 3.0E-84
sp|Q9PQS1|FTHS_UREPA Formate--tetrahydrofolate ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=fhs PE=3 SV=1 315 916 4.0E-79
sp|O65271|FOLD4_ARATH Bifunctional protein FolD 4, chloroplastic OS=Arabidopsis thaliana GN=FOLD4 PE=1 SV=1 3 288 1.0E-78
sp|A2RVV7|FOLD1_ARATH Bifunctional protein FolD 1, mitochondrial OS=Arabidopsis thaliana GN=FOLD1 PE=2 SV=1 6 286 7.0E-78
sp|Q8EUQ1|FTHS_MYCPE Formate--tetrahydrofolate ligase OS=Mycoplasma penetrans (strain HF-2) GN=fhs PE=3 SV=1 332 923 2.0E-77
sp|B9M769|FOLD_GEODF Bifunctional protein FolD OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=folD PE=3 SV=1 2 283 3.0E-75
sp|A1WUN4|FOLD_HALHL Bifunctional protein FolD OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=folD PE=3 SV=1 1 280 1.0E-74
sp|Q39WH4|FOLD2_GEOMG Bifunctional protein FolD 2 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=folD2 PE=3 SV=1 2 283 1.0E-74
sp|Q47IX6|FOLD_DECAR Bifunctional protein FolD OS=Dechloromonas aromatica (strain RCB) GN=folD PE=3 SV=1 1 283 1.0E-74
sp|A5GAM5|FOLD_GEOUR Bifunctional protein FolD OS=Geobacter uraniireducens (strain Rf4) GN=folD PE=3 SV=1 2 283 6.0E-74
sp|A3DEE6|FOLD_CLOTH Bifunctional protein FolD OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=folD PE=3 SV=1 1 280 2.0E-73
sp|B3QUL4|FOLD_CHLT3 Bifunctional protein FolD OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=folD PE=3 SV=1 6 285 2.0E-73
sp|Q73RS2|FOLD_TREDE Bifunctional protein FolD OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=folD PE=3 SV=1 1 283 3.0E-73
sp|C0ZC05|FOLD_BREBN Bifunctional protein FolD OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=folD PE=3 SV=1 1 283 2.0E-72
sp|Q2RIB4|FOLD_MOOTA Bifunctional protein FolD OS=Moorella thermoacetica (strain ATCC 39073) GN=folD PE=3 SV=1 1 283 5.0E-72
sp|A8FF15|FOLD_BACP2 Bifunctional protein FolD OS=Bacillus pumilus (strain SAFR-032) GN=folD PE=3 SV=1 1 283 8.0E-72
sp|Q2N7E3|FOLD_ERYLH Bifunctional protein FolD OS=Erythrobacter litoralis (strain HTCC2594) GN=folD PE=3 SV=1 1 283 9.0E-72
sp|A0LE04|FOLD_MAGMM Bifunctional protein FolD OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=folD PE=3 SV=1 2 283 1.0E-71
sp|Q7VM86|FOLD_HAEDU Bifunctional protein FolD OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=folD PE=3 SV=1 1 287 4.0E-71
sp|A7ZCH3|FOLD_CAMC1 Bifunctional protein FolD OS=Campylobacter concisus (strain 13826) GN=folD PE=3 SV=1 6 278 7.0E-71
sp|B3EJG9|FOLD_CHLPB Bifunctional protein FolD OS=Chlorobium phaeobacteroides (strain BS1) GN=folD PE=3 SV=1 44 283 7.0E-71
sp|P54382|FOLD_BACSU Bifunctional protein FolD OS=Bacillus subtilis (strain 168) GN=folD PE=3 SV=1 1 283 1.0E-70
sp|A4SER8|FOLD_CHLPM Bifunctional protein FolD OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=folD PE=3 SV=1 6 283 1.0E-70
sp|Q92BZ4|FOLD_LISIN Bifunctional protein FolD OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=folD PE=3 SV=1 6 285 1.0E-70
sp|Q3B4E2|FOLD_CHLL7 Bifunctional protein FolD OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=folD PE=3 SV=2 6 283 1.0E-70
sp|Q64RB7|FOLD_BACFR Bifunctional protein FolD OS=Bacteroides fragilis (strain YCH46) GN=folD PE=3 SV=1 4 278 2.0E-70
sp|Q5LAX0|FOLD_BACFN Bifunctional protein FolD OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=folD PE=3 SV=1 4 278 2.0E-70
sp|Q2S1I0|FOLD_SALRD Bifunctional protein FolD OS=Salinibacter ruber (strain DSM 13855 / M31) GN=folD PE=3 SV=1 3 280 2.0E-70
sp|B4S820|FOLD_PROA2 Bifunctional protein FolD OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=folD PE=3 SV=1 44 283 4.0E-70
sp|Q5P922|FOLD_AROAE Bifunctional protein FolD OS=Aromatoleum aromaticum (strain EbN1) GN=folD PE=3 SV=2 1 283 5.0E-70
sp|Q8A7B8|FOLD_BACTN Bifunctional protein FolD OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=folD PE=3 SV=1 4 278 5.0E-70
sp|B3CLT4|FOLD_WOLPP Bifunctional protein FolD OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=folD PE=3 SV=1 44 280 7.0E-70
sp|C0R2N7|FOLD_WOLWR Bifunctional protein FolD OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=folD PE=3 SV=1 6 280 1.0E-69
sp|A7GXK2|FOLD_CAMC5 Bifunctional protein FolD OS=Campylobacter curvus (strain 525.92) GN=folD PE=3 SV=1 6 278 2.0E-69
sp|Q2G338|FOLD_NOVAD Bifunctional protein FolD OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=folD PE=3 SV=1 1 283 2.0E-69
sp|Q9K966|FOLD_BACHD Bifunctional protein FolD OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=folD PE=3 SV=1 1 280 3.0E-69
sp|Q74EU7|FOLD2_GEOSL Bifunctional protein FolD 2 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=folD2 PE=3 SV=1 2 280 3.0E-69
sp|Q167Y9|FOLD1_ROSDO Bifunctional protein FolD 1 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=folD1 PE=3 SV=1 1 283 3.0E-69
sp|B8D2H8|FOLD_HALOH Bifunctional protein FolD OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=folD PE=3 SV=1 6 280 3.0E-69
sp|A7I254|FOLD_CAMHC Bifunctional protein FolD OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=folD PE=3 SV=1 6 280 3.0E-69
sp|B1YLQ1|FOLD_EXIS2 Bifunctional protein FolD OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=folD PE=3 SV=1 2 280 3.0E-69
sp|Q49WI7|FOLD_STAS1 Bifunctional protein FolD OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=folD PE=3 SV=1 1 292 4.0E-69
sp|Q73HK3|FOLD_WOLPM Bifunctional protein FolD OS=Wolbachia pipientis wMel GN=folD PE=3 SV=1 6 280 5.0E-69
sp|Q65HI8|FOLD_BACLD Bifunctional protein FolD OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=folD PE=3 SV=1 1 283 5.0E-69
sp|Q5GTK9|FOLD_WOLTR Bifunctional protein FolD OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=folD PE=3 SV=1 12 280 5.0E-69
sp|A6L2G2|FOLD_BACV8 Bifunctional protein FolD OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=folD PE=3 SV=1 6 276 6.0E-69
sp|Q1D7Y2|FOLD2_MYXXD Bifunctional protein FolD 2 OS=Myxococcus xanthus (strain DK 1622) GN=folD2 PE=3 SV=1 1 284 8.0E-69
sp|Q5NP22|FOLD_ZYMMO Bifunctional protein FolD OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=folD PE=3 SV=1 3 280 9.0E-69
sp|A1K589|FOLD_AZOSB Bifunctional protein FolD OS=Azoarcus sp. (strain BH72) GN=folD PE=3 SV=1 1 283 1.0E-68
sp|B9DQ45|FOLD_STACT Bifunctional protein FolD OS=Staphylococcus carnosus (strain TM300) GN=folD PE=3 SV=1 1 292 1.0E-68
sp|B8DFW8|FOLD_LISMH Bifunctional protein FolD OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=folD PE=3 SV=1 6 285 1.0E-68
sp|Q1WUJ3|FOLD_LACS1 Bifunctional protein FolD OS=Lactobacillus salivarius (strain UCC118) GN=folD PE=3 SV=1 1 283 2.0E-68
sp|B3ECA6|FOLD_CHLL2 Bifunctional protein FolD OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=folD PE=3 SV=1 44 283 2.0E-68
sp|C1L2R6|FOLD_LISMC Bifunctional protein FolD OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=folD PE=3 SV=1 6 285 2.0E-68
sp|A8FTH7|FOLD_SHESH Bifunctional protein FolD OS=Shewanella sediminis (strain HAW-EB3) GN=folD PE=3 SV=1 1 284 3.0E-68
sp|Q8Y7C5|FOLD_LISMO Bifunctional protein FolD OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=folD PE=3 SV=1 6 285 3.0E-68
sp|B6YRQ9|FOLD_AZOPC Bifunctional protein FolD OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=folD PE=3 SV=1 4 287 4.0E-68
sp|B4SGR4|FOLD_PELPB Bifunctional protein FolD OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=folD PE=3 SV=1 6 284 4.0E-68
sp|Q81M50|FOLD_BACAN Bifunctional protein FolD OS=Bacillus anthracis GN=folD PE=3 SV=1 1 289 4.0E-68
sp|C3LJV5|FOLD_BACAC Bifunctional protein FolD OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=folD PE=3 SV=1 1 289 4.0E-68
sp|C3P7W0|FOLD_BACAA Bifunctional protein FolD OS=Bacillus anthracis (strain A0248) GN=folD PE=3 SV=1 1 289 4.0E-68
sp|B7IXH2|FOLD_BACC2 Bifunctional protein FolD OS=Bacillus cereus (strain G9842) GN=folD PE=3 SV=1 1 289 5.0E-68
sp|Q48HJ1|FOLD2_PSE14 Bifunctional protein FolD 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=folD2 PE=3 SV=1 1 291 5.0E-68
sp|Q4FNW1|FOLD_PELUB Bifunctional protein FolD OS=Pelagibacter ubique (strain HTCC1062) GN=folD PE=3 SV=1 6 283 5.0E-68
sp|B7HB52|FOLD_BACC4 Bifunctional protein FolD OS=Bacillus cereus (strain B4264) GN=folD PE=3 SV=1 1 289 6.0E-68
sp|Q1GE28|FOLD_RUEST Bifunctional protein FolD OS=Ruegeria sp. (strain TM1040) GN=folD PE=3 SV=1 1 283 6.0E-68
sp|Q7MVE9|FOLD_PORGI Bifunctional protein FolD OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=folD PE=3 SV=1 6 285 7.0E-68
sp|A5FNE3|FOLD_FLAJ1 Bifunctional protein FolD OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=folD PE=3 SV=1 6 278 7.0E-68
sp|Q818R5|FOLD_BACCR Bifunctional protein FolD OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=folD PE=3 SV=1 1 289 7.0E-68
sp|A4XLE0|FOLD_CALS8 Bifunctional protein FolD OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=folD PE=3 SV=1 11 281 1.0E-67
sp|P0C277|FOLD_NEIMB Bifunctional protein FolD OS=Neisseria meningitidis serogroup B (strain MC58) GN=folD PE=3 SV=1 1 280 1.0E-67
sp|B1HRX9|FOLD_LYSSC Bifunctional protein FolD OS=Lysinibacillus sphaericus (strain C3-41) GN=folD PE=3 SV=1 1 283 1.0E-67
sp|Q731B2|FOLD_BACC1 Bifunctional protein FolD OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=folD PE=3 SV=1 1 289 1.0E-67
sp|Q4ZUA4|FOLD2_PSEU2 Bifunctional protein FolD 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=folD2 PE=3 SV=1 1 291 1.0E-67
sp|Q4L572|FOLD_STAHJ Bifunctional protein FolD OS=Staphylococcus haemolyticus (strain JCSC1435) GN=folD PE=3 SV=1 1 292 1.0E-67
sp|Q8EG21|FOLD_SHEON Bifunctional protein FolD OS=Shewanella oneidensis (strain MR-1) GN=folD PE=3 SV=1 1 284 1.0E-67
sp|A6L8J2|FOLD_PARD8 Bifunctional protein FolD OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=folD PE=3 SV=1 6 280 2.0E-67
sp|Q8FVP6|FOLD_BRUSU Bifunctional protein FolD OS=Brucella suis biovar 1 (strain 1330) GN=folD PE=3 SV=1 44 283 2.0E-67
sp|A9WZ75|FOLD_BRUSI Bifunctional protein FolD OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=folD PE=3 SV=1 44 283 2.0E-67
sp|A5VV73|FOLD_BRUO2 Bifunctional protein FolD OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=folD PE=3 SV=1 44 283 2.0E-67
sp|Q8YCL8|FOLD_BRUME Bifunctional protein FolD OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=folD PE=3 SV=2 44 283 2.0E-67
sp|C0RLT3|FOLD_BRUMB Bifunctional protein FolD OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=folD PE=3 SV=1 44 283 2.0E-67
sp|A9MC67|FOLD_BRUC2 Bifunctional protein FolD OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=folD PE=3 SV=1 44 283 2.0E-67
sp|Q578R0|FOLD_BRUAB Bifunctional protein FolD OS=Brucella abortus biovar 1 (strain 9-941) GN=folD PE=3 SV=1 44 283 2.0E-67
sp|Q2YL33|FOLD_BRUA2 Bifunctional protein FolD OS=Brucella abortus (strain 2308) GN=folD PE=3 SV=1 44 283 2.0E-67
sp|B2SAP4|FOLD_BRUA1 Bifunctional protein FolD OS=Brucella abortus (strain S19) GN=folD PE=3 SV=1 44 283 2.0E-67
sp|A7Z6J9|FOLD_BACMF Bifunctional protein FolD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=folD PE=3 SV=1 1 283 2.0E-67
sp|B1KLT9|FOLD_SHEWM Bifunctional protein FolD OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=folD PE=3 SV=1 1 284 2.0E-67
sp|Q635A3|FOLD_BACCZ Bifunctional protein FolD OS=Bacillus cereus (strain ZK / E33L) GN=folD PE=3 SV=1 1 289 2.0E-67
sp|Q9JWI9|FOLD_NEIMA Bifunctional protein FolD OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=folD PE=3 SV=1 1 280 2.0E-67
sp|A9M068|FOLD_NEIM0 Bifunctional protein FolD OS=Neisseria meningitidis serogroup C (strain 053442) GN=folD PE=3 SV=2 1 280 2.0E-67
sp|B9IXH4|FOLD_BACCQ Bifunctional protein FolD OS=Bacillus cereus (strain Q1) GN=folD PE=3 SV=1 1 289 2.0E-67
sp|B7HNU4|FOLD_BACC7 Bifunctional protein FolD OS=Bacillus cereus (strain AH187) GN=folD PE=3 SV=1 1 289 2.0E-67
sp|Q6HDY4|FOLD_BACHK Bifunctional protein FolD OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=folD PE=3 SV=1 1 289 3.0E-67
sp|C1ERQ4|FOLD_BACC3 Bifunctional protein FolD OS=Bacillus cereus (strain 03BB102) GN=folD PE=3 SV=1 1 289 3.0E-67
sp|B7JM32|FOLD_BACC0 Bifunctional protein FolD OS=Bacillus cereus (strain AH820) GN=folD PE=3 SV=1 1 289 3.0E-67
sp|A0RIH3|FOLD_BACAH Bifunctional protein FolD OS=Bacillus thuringiensis (strain Al Hakam) GN=folD PE=3 SV=1 1 289 3.0E-67
sp|O65269|FOLD3_ARATH Bifunctional protein FolD 3, chloroplastic OS=Arabidopsis thaliana GN=FOLD3 PE=3 SV=1 3 288 3.0E-67
sp|Q5LNV2|FOLD1_RUEPO Bifunctional protein FolD 1/3 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=folD1 PE=3 SV=1 1 283 4.0E-67
sp|A4Y5I0|FOLD_SHEPC Bifunctional protein FolD OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=folD PE=3 SV=1 1 284 4.0E-67
sp|B0BPI2|FOLD_ACTPJ Bifunctional protein FolD OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=folD PE=3 SV=1 1 280 4.0E-67
sp|B3GXP3|FOLD_ACTP7 Bifunctional protein FolD OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=folD PE=3 SV=1 1 280 4.0E-67
sp|A7GSJ9|FOLD_BACCN Bifunctional protein FolD OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=folD PE=3 SV=1 1 283 4.0E-67
sp|A3N0Q7|FOLD_ACTP2 Bifunctional protein FolD OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=folD PE=3 SV=1 1 280 4.0E-67
sp|B7GHF9|FOLD_ANOFW Bifunctional protein FolD OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=folD PE=3 SV=1 1 280 5.0E-67
sp|Q8NX95|FOLD_STAAW Bifunctional protein FolD OS=Staphylococcus aureus (strain MW2) GN=folD PE=3 SV=1 1 292 5.0E-67
sp|A8Z1K5|FOLD_STAAT Bifunctional protein FolD OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=folD PE=3 SV=1 1 292 5.0E-67
sp|Q6GAF0|FOLD_STAAS Bifunctional protein FolD OS=Staphylococcus aureus (strain MSSA476) GN=folD PE=3 SV=1 1 292 5.0E-67
sp|A6QFS2|FOLD_STAAE Bifunctional protein FolD OS=Staphylococcus aureus (strain Newman) GN=folD PE=3 SV=1 1 292 5.0E-67
sp|Q5HH21|FOLD_STAAC Bifunctional protein FolD OS=Staphylococcus aureus (strain COL) GN=folD PE=3 SV=1 1 292 5.0E-67
sp|Q2FZJ6|FOLD_STAA8 Bifunctional protein FolD OS=Staphylococcus aureus (strain NCTC 8325) GN=folD PE=3 SV=1 1 292 5.0E-67
sp|Q2FI15|FOLD_STAA3 Bifunctional protein FolD OS=Staphylococcus aureus (strain USA300) GN=folD PE=3 SV=1 1 292 5.0E-67
sp|B9DUU0|FOLD_STRU0 Bifunctional protein FolD OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=folD PE=3 SV=1 6 283 5.0E-67
sp|Q71ZW2|FOLD_LISMF Bifunctional protein FolD OS=Listeria monocytogenes serotype 4b (strain F2365) GN=folD PE=3 SV=1 6 285 5.0E-67
sp|A1KWF4|FOLD_NEIMF Bifunctional protein FolD OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=folD PE=3 SV=1 1 280 6.0E-67
sp|A9ISZ5|FOLD_BORPD Bifunctional protein FolD OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=folD PE=3 SV=1 6 283 6.0E-67
sp|Q18GK1|FOLD_HALWD Bifunctional protein FolD OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=folD PE=3 SV=1 6 281 6.0E-67
sp|B8CRF9|FOLD_SHEPW Bifunctional protein FolD OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=folD PE=3 SV=1 1 284 7.0E-67
sp|C4ZBG7|FOLD_EUBR3 Bifunctional protein FolD OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=folD PE=3 SV=1 2 283 8.0E-67
sp|A1AL91|FOLD_PELPD Bifunctional protein FolD OS=Pelobacter propionicus (strain DSM 2379) GN=folD PE=3 SV=1 6 283 8.0E-67
sp|Q160C1|FOLD2_ROSDO Bifunctional protein FolD 2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=folD2 PE=3 SV=1 1 283 8.0E-67
sp|A8H616|FOLD_SHEPA Bifunctional protein FolD OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=folD PE=3 SV=1 1 284 8.0E-67
sp|A9VGW3|FOLD_BACWK Bifunctional protein FolD OS=Bacillus weihenstephanensis (strain KBAB4) GN=folD PE=3 SV=1 1 283 1.0E-66
sp|Q6GI21|FOLD_STAAR Bifunctional protein FolD OS=Staphylococcus aureus (strain MRSA252) GN=folD PE=3 SV=1 1 292 1.0E-66
sp|Q9CH85|FOLD_LACLA Bifunctional protein FolD OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=folD PE=3 SV=2 6 289 1.0E-66
sp|Q7A697|FOLD_STAAN Bifunctional protein FolD OS=Staphylococcus aureus (strain N315) GN=folD PE=1 SV=1 1 292 1.0E-66
sp|Q99V34|FOLD_STAAM Bifunctional protein FolD OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=folD PE=3 SV=1 1 292 1.0E-66
sp|A5IRV0|FOLD_STAA9 Bifunctional protein FolD OS=Staphylococcus aureus (strain JH9) GN=folD PE=3 SV=1 1 292 1.0E-66
sp|A6U0N1|FOLD_STAA2 Bifunctional protein FolD OS=Staphylococcus aureus (strain JH1) GN=folD PE=3 SV=1 1 292 1.0E-66
sp|A7X0V3|FOLD_STAA1 Bifunctional protein FolD OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=folD PE=3 SV=1 1 292 1.0E-66
sp|Q2YX11|FOLD_STAAB Bifunctional protein FolD OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=folD PE=3 SV=1 1 294 1.0E-66
sp|Q3ASI0|FOLD_CHLCH Bifunctional protein FolD OS=Chlorobium chlorochromatii (strain CaD3) GN=folD PE=3 SV=1 44 283 2.0E-66
sp|A1RL91|FOLD_SHESW Bifunctional protein FolD OS=Shewanella sp. (strain W3-18-1) GN=folD PE=3 SV=1 1 284 2.0E-66
sp|Q8E168|FOLD_STRA5 Bifunctional protein FolD OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=folD PE=3 SV=1 6 283 2.0E-66
sp|Q8E6M3|FOLD_STRA3 Bifunctional protein FolD OS=Streptococcus agalactiae serotype III (strain NEM316) GN=folD PE=3 SV=1 6 283 2.0E-66
sp|Q3K2M6|FOLD_STRA1 Bifunctional protein FolD OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=folD PE=3 SV=1 6 283 2.0E-66
sp|A1S4X3|FOLD_SHEAM Bifunctional protein FolD OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=folD PE=3 SV=1 1 284 2.0E-66
sp|Q0HTK5|FOLD_SHESR Bifunctional protein FolD OS=Shewanella sp. (strain MR-7) GN=folD PE=3 SV=1 1 284 3.0E-66
sp|A0Q505|FOLD_FRATN Bifunctional protein FolD OS=Francisella tularensis subsp. novicida (strain U112) GN=folD PE=3 SV=1 6 292 3.0E-66
sp|B4RE11|FOLD_PHEZH Bifunctional protein FolD OS=Phenylobacterium zucineum (strain HLK1) GN=folD PE=3 SV=1 1 284 3.0E-66
sp|C1DHE7|FOLD_AZOVD Bifunctional protein FolD OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=folD PE=3 SV=1 1 284 3.0E-66
sp|A6X610|FOLD_OCHA4 Bifunctional protein FolD OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=folD PE=3 SV=1 44 283 4.0E-66
sp|A1BF67|FOLD_CHLPD Bifunctional protein FolD OS=Chlorobium phaeobacteroides (strain DSM 266) GN=folD PE=3 SV=2 6 284 4.0E-66
sp|B4RQN5|FOLD_NEIG2 Bifunctional protein FolD OS=Neisseria gonorrhoeae (strain NCCP11945) GN=folD PE=3 SV=1 1 280 5.0E-66
sp|Q5F5D0|FOLD_NEIG1 Bifunctional protein FolD OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=folD PE=3 SV=1 1 280 5.0E-66
sp|A6V726|FOLD_PSEA7 Bifunctional protein FolD OS=Pseudomonas aeruginosa (strain PA7) GN=folD PE=3 SV=1 1 285 5.0E-66
sp|B2A532|FOLD_NATTJ Bifunctional protein FolD OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=folD PE=3 SV=1 1 288 5.0E-66
sp|Q2L1G0|FOLD_BORA1 Bifunctional protein FolD OS=Bordetella avium (strain 197N) GN=folD PE=3 SV=1 1 285 6.0E-66
sp|C4LG01|FOLD_TOLAT Bifunctional protein FolD OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=folD PE=3 SV=1 1 284 6.0E-66
sp|B0T3F7|FOLD_CAUSK Bifunctional protein FolD OS=Caulobacter sp. (strain K31) GN=folD PE=3 SV=1 6 284 6.0E-66
sp|A9KWH5|FOLD_SHEB9 Bifunctional protein FolD OS=Shewanella baltica (strain OS195) GN=folD PE=3 SV=1 1 284 9.0E-66
sp|Q989A7|FOLD1_RHILO Bifunctional protein FolD 1 OS=Rhizobium loti (strain MAFF303099) GN=folD1 PE=3 SV=1 2 278 9.0E-66
sp|Q0HH99|FOLD_SHESM Bifunctional protein FolD OS=Shewanella sp. (strain MR-4) GN=folD PE=3 SV=1 1 284 1.0E-65
sp|A0KYM1|FOLD_SHESA Bifunctional protein FolD OS=Shewanella sp. (strain ANA-3) GN=folD PE=3 SV=1 1 284 1.0E-65
sp|A4IQS0|FOLD_GEOTN Bifunctional protein FolD OS=Geobacillus thermodenitrificans (strain NG80-2) GN=folD PE=3 SV=1 1 284 1.0E-65
sp|A4IYR4|FOLD_FRATW Bifunctional protein FolD OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=folD PE=3 SV=1 6 292 1.0E-65
sp|Q5NGF3|FOLD_FRATT Bifunctional protein FolD OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=folD PE=1 SV=1 6 292 1.0E-65
sp|Q14HV5|FOLD_FRAT1 Bifunctional protein FolD OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=folD PE=3 SV=1 6 292 1.0E-65
sp|Q8CPP4|FOLD_STAES Bifunctional protein FolD OS=Staphylococcus epidermidis (strain ATCC 12228) GN=folD PE=3 SV=1 1 292 1.0E-65
sp|Q97RI9|FOLD_STRPN Bifunctional protein FolD OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=folD PE=3 SV=1 6 283 1.0E-65
sp|Q5HQA7|FOLD_STAEQ Bifunctional protein FolD OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=folD PE=3 SV=1 1 292 1.0E-65
sp|A1B5A7|FOLD1_PARDP Bifunctional protein FolD 1 OS=Paracoccus denitrificans (strain Pd 1222) GN=folD1 PE=3 SV=1 1 283 2.0E-65
sp|A6WLP9|FOLD_SHEB8 Bifunctional protein FolD OS=Shewanella baltica (strain OS185) GN=folD PE=3 SV=1 1 284 2.0E-65
sp|A3D303|FOLD_SHEB5 Bifunctional protein FolD OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=folD PE=3 SV=1 1 284 2.0E-65
sp|B8E5F1|FOLD_SHEB2 Bifunctional protein FolD OS=Shewanella baltica (strain OS223) GN=folD PE=3 SV=1 1 284 2.0E-65
sp|C5B8V3|FOLD_EDWI9 Bifunctional protein FolD OS=Edwardsiella ictaluri (strain 93-146) GN=folD PE=3 SV=1 1 284 2.0E-65
sp|Q2VYZ7|FOLD_MAGSA Bifunctional protein FolD OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=folD PE=3 SV=1 3 284 3.0E-65
sp|Q8DQD3|FOLD_STRR6 Bifunctional protein FolD OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=folD PE=3 SV=2 6 283 3.0E-65
sp|Q04L84|FOLD_STRP2 Bifunctional protein FolD OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=folD PE=3 SV=2 6 283 3.0E-65
sp|Q9I2U6|FOLD_PSEAE Bifunctional protein FolD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=folD PE=1 SV=1 1 285 3.0E-65
sp|Q02KT7|FOLD_PSEAB Bifunctional protein FolD OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=folD PE=3 SV=1 1 285 3.0E-65
sp|B7VB83|FOLD_PSEA8 Bifunctional protein FolD OS=Pseudomonas aeruginosa (strain LESB58) GN=folD PE=3 SV=1 1 285 3.0E-65
sp|A8I5P5|FOLD_AZOC5 Bifunctional protein FolD OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=folD PE=3 SV=1 1 283 3.0E-65
sp|C0M7V0|FOLD_STRE4 Bifunctional protein FolD OS=Streptococcus equi subsp. equi (strain 4047) GN=folD PE=3 SV=1 6 283 3.0E-65
sp|Q7WJG1|FOLD_BORBR Bifunctional protein FolD OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=folD PE=3 SV=1 1 283 3.0E-65
sp|Q7VZC8|FOLD1_BORPE Bifunctional protein FolD 1 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=folD1 PE=3 SV=1 1 283 3.0E-65
sp|Q7WAC0|FOLD1_BORPA Bifunctional protein FolD 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=folD1 PE=3 SV=1 1 283 3.0E-65
sp|A4VTM4|FOLD_STRSY Bifunctional protein FolD OS=Streptococcus suis (strain 05ZYH33) GN=folD PE=3 SV=1 4 283 3.0E-65
sp|Q07ZX6|FOLD_SHEFN Bifunctional protein FolD OS=Shewanella frigidimarina (strain NCIMB 400) GN=folD PE=3 SV=1 1 284 3.0E-65
sp|B2SF67|FOLD_FRATM Bifunctional protein FolD OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=folD PE=3 SV=1 6 292 5.0E-65
sp|A5CVZ6|FOLD_VESOH Bifunctional protein FolD OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=folD PE=3 SV=1 12 280 5.0E-65
sp|Q2GHD8|FOLD_EHRCR Bifunctional protein FolD OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=folD PE=3 SV=1 6 280 5.0E-65
sp|A0Q0A0|FOLD_CLONN Bifunctional protein FolD OS=Clostridium novyi (strain NT) GN=folD PE=3 SV=1 2 280 5.0E-65
sp|Q12L99|FOLD_SHEDO Bifunctional protein FolD OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=folD PE=3 SV=1 1 284 6.0E-65
sp|B8I761|FOLD_CLOCE Bifunctional protein FolD OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=folD PE=3 SV=1 1 280 7.0E-65
sp|C0MD36|FOLD_STRS7 Bifunctional protein FolD OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=folD PE=3 SV=1 6 283 8.0E-65
sp|A4VZV9|FOLD_STRS2 Bifunctional protein FolD OS=Streptococcus suis (strain 98HAH33) GN=folD PE=3 SV=1 4 283 8.0E-65
sp|A3QFX8|FOLD_SHELP Bifunctional protein FolD OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=folD PE=3 SV=1 1 284 8.0E-65
sp|A4SWT5|FOLD_POLSQ Bifunctional protein FolD OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=folD PE=3 SV=1 1 283 8.0E-65
sp|A0AIG1|FOLD_LISW6 Bifunctional protein FolD OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=folD PE=3 SV=1 6 285 9.0E-65
sp|Q38X32|FTHS_LACSS Formate--tetrahydrofolate ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=fhs PE=3 SV=1 317 476 3.0E-28
sp|Q03S45|FTHS_LACBA Formate--tetrahydrofolate ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=fhs PE=3 SV=1 307 478 1.0E-24
sp|Q038Y4|FTHS_LACC3 Formate--tetrahydrofolate ligase OS=Lactobacillus casei (strain ATCC 334) GN=fhs PE=3 SV=1 318 476 2.0E-24
sp|B3WEG3|FTHS_LACCB Formate--tetrahydrofolate ligase OS=Lactobacillus casei (strain BL23) GN=fhs PE=3 SV=1 318 476 2.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004488 methylenetetrahydrofolate dehydrogenase (NADP+) activity Yes
GO:0004329 formate-tetrahydrofolate ligase activity Yes
GO:0004486 methylenetetrahydrofolate dehydrogenase [NAD(P)+] activity No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0016645 oxidoreductase activity, acting on the CH-NH group of donors No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0016646 oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0016491 oxidoreductase activity No
GO:0016874 ligase activity No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4538
MVATRLDGTALARRIREGIAAEIVQKQQVNPRYKPFFTIIQATYVRMKLKAAQEAGIGCELLALDESITEFELLD
HIRRLNQDSAINGILVQLPLPGHLSERNVTSAVAGEKDVDGFGTDNIGELAKRGGSPVFIPCTPMGVMLLLAEAG
VEVAGKSAVVLGRSNIVGGPVSHLLRNADCTVTVCHSKTNGLQRYLADADIVVAAIGQPQFIKGEWLKEGAIVID
VGTNFIPDASKKTGQRLVGDVDFESASRVASAITPVPGGVGPMTVAMLLRNVVDATDRFFVAQKRRRIVPLPLKL
RDPVPSDSAISREQVPKPIVAVAEELGIPPHELEPYGTYKAKIHLGLLDRLAHRRDGRYVVVTGITPTPLGEGKS
TTTVGLAQALGAHLGRLTFANVRQPSQGPTFGIKGGAAGGGYSQVTPMDEFNLHLTGDIHAVTAANNLLAAALES
RMFHEQTQKDGPLYRRLVPVKDGSRRFTPAMLRRLARLGIDKTDPDALTEDEVRRFARLDVDPDTITWRRVLDVN
DRHLRGVTVGTAATEKGHSRQTGFDISVASECMAILALSNSLGDMRDRLGRMVVATSLRGEAVTCDDLGATGALT
ALMRDAIKPNLMQTLEGTPVLVHAGPFANISIGQSSIVADRLALKLAGTEADEEPTAAGFVVTEAGFDFTMGGER
FFNIKCRTSGLVPDVVVVVATVRALKVHGGGPPIAPGAPLDAVYKREDVDLVRAGCVNLRKHITNARSFGVPVVV
AINRFATDSPAEVAAVREEATAAGAEDAVLAEHWSRGGAGAVDLARAVAAAAEMPRGELRLTYGLQGNTALERIE
AIAKKLYGADGVQLSELARTKLATYEKQGYGGLPICIAKTQYSLSHDAQLKGAPTGFTVPIGDVRLAAGAGYLYA
LAADIQTMPGLPTAPGYLNIDVDCCTGEIDGLF*
Coding >Ophun1|4538
ATGGTCGCTACGAGGCTCGATGGCACTGCCCTTGCGCGACGCATTCGCGAGGGCATTGCGGCCGAGATTGTGCAG
AAGCAACAGGTGAATCCTCGGTACAAGCCGTTTTTTACCATTATTCAAGCAACATATGTGCGCATGAAGCTCAAG
GCCGCTCAAGAGGCCGGTATCGGCTGCGAGCTGCTGGCCTTGGACGAGTCCATCACTGAGTTTGAGCTCCTTGAC
CATATCCGCCGACTCAACCAGGATTCGGCCATCAACGGCATCCTGGTACAGTTGCCGCTTCCCGGCCACCTCTCG
GAGCGCAACGTCACGTCGGCCGTGGCTGGCGAGAAAGACGTCGATGGCTTCGGCACTGACAACATCGGCGAGCTC
GCCAAGCGCGGCGGCAGCCCCGTATTCATCCCGTGCACCCCCATGGGCGTCATGCTGCTCCTGGCCGAGGCTGGC
GTCGAGGTCGCCGGTAAGTCGGCCGTGGTGTTGGGCCGGAGCAACATCGTCGGCGGGCCCGTCAGTCATCTGCTG
CGCAACGCAGACTGCACGGTGACCGTCTGTCACTCCAAGACAAATGGGCTTCAGCGTTACCTCGCCGATGCCGAC
ATCGTCGTCGCCGCCATCGGCCAGCCGCAGTTTATCAAGGGCGAGTGGCTCAAGGAGGGTGCCATCGTTATAGAC
GTCGGCACAAACTTCATCCCGGACGCCAGCAAGAAGACGGGACAGCGGCTGGTGGGCGACGTCGACTTCGAGTCG
GCGTCTCGCGTCGCCTCGGCCATCACTCCCGTCCCCGGTGGCGTCGGACCCATGACGGTGGCCATGCTTCTCCGC
AACGTCGTCGACGCCACCGACCGCTTCTTCGTGGCGCAGAAGCGGCGTCGCATCGTGCCCCTGCCCCTGAAGCTC
AGGGACCCGGTGCCGTCAGACAGCGCCATCTCGAGGGAGCAGGTGCCCAAGCCCATCGTGGCCGTCGCCGAAGAG
TTGGGAATCCCCCCGCACGAGCTGGAGCCGTACGGCACCTACAAGGCCAAGATCCATCTCGGCCTCCTCGATAGG
CTGGCGCATCGGCGGGACGGCCGCTACGTGGTGGTGACGGGCATCACGCCCACGCCTCTGGGTGAGGGCAAGTCG
ACAACGACTGTCGGGTTGGCCCAGGCTTTGGGTGCCCACCTCGGCCGGCTGACGTTTGCCAACGTGCGGCAGCCC
AGCCAGGGGCCGACGTTTGGCATCAAGGGGGGCGCTGCGGGCGGTGGCTACAGCCAGGTGACGCCCATGGACGAG
TTCAACCTGCACCTCACGGGCGATATCCACGCCGTGACGGCGGCCAACAACCTGCTGGCGGCGGCGCTCGAGTCG
CGCATGTTCCACGAGCAGACACAAAAGGACGGGCCGCTGTACCGGAGACTGGTGCCGGTCAAGGACGGCTCGCGC
CGTTTCACGCCCGCCATGTTGCGGCGGCTGGCCCGGCTGGGCATCGACAAGACGGATCCGGACGCGCTGACCGAG
GACGAGGTCCGGCGCTTCGCCCGGCTCGACGTCGACCCGGACACCATTACGTGGAGGCGGGTGCTAGACGTCAAC
GACCGCCATCTCCGAGGCGTCACCGTCGGCACGGCGGCCACGGAGAAGGGCCACTCTCGCCAGACGGGCTTCGAC
ATCTCCGTCGCCAGCGAGTGCATGGCCATCCTGGCCCTCAGCAACAGCCTGGGCGATATGCGCGACAGGCTGGGC
CGCATGGTAGTGGCGACGTCGCTCAGAGGCGAGGCTGTCACCTGCGACGACCTGGGGGCCACGGGAGCGCTGACG
GCACTGATGAGGGACGCCATCAAGCCCAACCTGATGCAGACGCTCGAGGGGACGCCGGTGCTGGTGCACGCGGGC
CCGTTTGCCAACATCAGCATCGGCCAGAGCTCCATTGTGGCAGACCGGCTGGCGCTCAAGCTGGCGGGCACGGAG
GCGGACGAGGAGCCGACGGCGGCGGGCTTCGTCGTGACCGAGGCGGGCTTCGACTTTACCATGGGCGGCGAGCGC
TTCTTCAACATCAAGTGCCGGACTTCGGGCCTGGTCCCGGACGTTGTTGTGGTGGTGGCGACGGTGAGGGCTCTC
AAGGTGCACGGCGGTGGACCCCCGATCGCCCCGGGAGCGCCGCTCGACGCCGTCTACAAGCGGGAGGACGTCGAT
CTGGTGCGGGCGGGCTGTGTCAACCTGCGGAAGCACATCACCAACGCGCGATCTTTTGGTGTGCCCGTCGTCGTG
GCCATCAACCGGTTCGCGACGGACAGCCCGGCCGAGGTGGCGGCGGTGCGGGAGGAGGCGACGGCTGCCGGGGCC
GAAGATGCCGTCCTGGCCGAGCACTGGTCACGGGGCGGGGCCGGGGCCGTGGACTTGGCTCGGGCGGTGGCGGCG
GCGGCGGAGATGCCCCGAGGCGAGCTCCGACTGACGTACGGCTTGCAAGGAAACACGGCGCTGGAGAGGATCGAG
GCCATCGCCAAGAAGCTGTACGGGGCCGATGGAGTGCAGCTCAGCGAACTGGCACGCACCAAGCTGGCGACGTAC
GAGAAGCAGGGCTACGGCGGCCTGCCCATCTGCATCGCCAAGACGCAGTACTCGCTGTCGCATGACGCGCAACTC
AAGGGCGCCCCGACGGGCTTTACGGTGCCGATCGGCGACGTGCGGCTGGCTGCTGGGGCGGGTTACCTATACGCG
CTGGCGGCGGACATACAGACGATGCCGGGCTTGCCGACGGCACCGGGCTACCTAAACATCGACGTCGACTGCTGT
ACGGGAGAGATCGACGGCTTGTTCTGA
Transcript >Ophun1|4538
ATGGTCGCTACGAGGCTCGATGGCACTGCCCTTGCGCGACGCATTCGCGAGGGCATTGCGGCCGAGATTGTGCAG
AAGCAACAGGTGAATCCTCGGTACAAGCCGTTTTTTACCATTATTCAAGCAACATATGTGCGCATGAAGCTCAAG
GCCGCTCAAGAGGCCGGTATCGGCTGCGAGCTGCTGGCCTTGGACGAGTCCATCACTGAGTTTGAGCTCCTTGAC
CATATCCGCCGACTCAACCAGGATTCGGCCATCAACGGCATCCTGGTACAGTTGCCGCTTCCCGGCCACCTCTCG
GAGCGCAACGTCACGTCGGCCGTGGCTGGCGAGAAAGACGTCGATGGCTTCGGCACTGACAACATCGGCGAGCTC
GCCAAGCGCGGCGGCAGCCCCGTATTCATCCCGTGCACCCCCATGGGCGTCATGCTGCTCCTGGCCGAGGCTGGC
GTCGAGGTCGCCGGTAAGTCGGCCGTGGTGTTGGGCCGGAGCAACATCGTCGGCGGGCCCGTCAGTCATCTGCTG
CGCAACGCAGACTGCACGGTGACCGTCTGTCACTCCAAGACAAATGGGCTTCAGCGTTACCTCGCCGATGCCGAC
ATCGTCGTCGCCGCCATCGGCCAGCCGCAGTTTATCAAGGGCGAGTGGCTCAAGGAGGGTGCCATCGTTATAGAC
GTCGGCACAAACTTCATCCCGGACGCCAGCAAGAAGACGGGACAGCGGCTGGTGGGCGACGTCGACTTCGAGTCG
GCGTCTCGCGTCGCCTCGGCCATCACTCCCGTCCCCGGTGGCGTCGGACCCATGACGGTGGCCATGCTTCTCCGC
AACGTCGTCGACGCCACCGACCGCTTCTTCGTGGCGCAGAAGCGGCGTCGCATCGTGCCCCTGCCCCTGAAGCTC
AGGGACCCGGTGCCGTCAGACAGCGCCATCTCGAGGGAGCAGGTGCCCAAGCCCATCGTGGCCGTCGCCGAAGAG
TTGGGAATCCCCCCGCACGAGCTGGAGCCGTACGGCACCTACAAGGCCAAGATCCATCTCGGCCTCCTCGATAGG
CTGGCGCATCGGCGGGACGGCCGCTACGTGGTGGTGACGGGCATCACGCCCACGCCTCTGGGTGAGGGCAAGTCG
ACAACGACTGTCGGGTTGGCCCAGGCTTTGGGTGCCCACCTCGGCCGGCTGACGTTTGCCAACGTGCGGCAGCCC
AGCCAGGGGCCGACGTTTGGCATCAAGGGGGGCGCTGCGGGCGGTGGCTACAGCCAGGTGACGCCCATGGACGAG
TTCAACCTGCACCTCACGGGCGATATCCACGCCGTGACGGCGGCCAACAACCTGCTGGCGGCGGCGCTCGAGTCG
CGCATGTTCCACGAGCAGACACAAAAGGACGGGCCGCTGTACCGGAGACTGGTGCCGGTCAAGGACGGCTCGCGC
CGTTTCACGCCCGCCATGTTGCGGCGGCTGGCCCGGCTGGGCATCGACAAGACGGATCCGGACGCGCTGACCGAG
GACGAGGTCCGGCGCTTCGCCCGGCTCGACGTCGACCCGGACACCATTACGTGGAGGCGGGTGCTAGACGTCAAC
GACCGCCATCTCCGAGGCGTCACCGTCGGCACGGCGGCCACGGAGAAGGGCCACTCTCGCCAGACGGGCTTCGAC
ATCTCCGTCGCCAGCGAGTGCATGGCCATCCTGGCCCTCAGCAACAGCCTGGGCGATATGCGCGACAGGCTGGGC
CGCATGGTAGTGGCGACGTCGCTCAGAGGCGAGGCTGTCACCTGCGACGACCTGGGGGCCACGGGAGCGCTGACG
GCACTGATGAGGGACGCCATCAAGCCCAACCTGATGCAGACGCTCGAGGGGACGCCGGTGCTGGTGCACGCGGGC
CCGTTTGCCAACATCAGCATCGGCCAGAGCTCCATTGTGGCAGACCGGCTGGCGCTCAAGCTGGCGGGCACGGAG
GCGGACGAGGAGCCGACGGCGGCGGGCTTCGTCGTGACCGAGGCGGGCTTCGACTTTACCATGGGCGGCGAGCGC
TTCTTCAACATCAAGTGCCGGACTTCGGGCCTGGTCCCGGACGTTGTTGTGGTGGTGGCGACGGTGAGGGCTCTC
AAGGTGCACGGCGGTGGACCCCCGATCGCCCCGGGAGCGCCGCTCGACGCCGTCTACAAGCGGGAGGACGTCGAT
CTGGTGCGGGCGGGCTGTGTCAACCTGCGGAAGCACATCACCAACGCGCGATCTTTTGGTGTGCCCGTCGTCGTG
GCCATCAACCGGTTCGCGACGGACAGCCCGGCCGAGGTGGCGGCGGTGCGGGAGGAGGCGACGGCTGCCGGGGCC
GAAGATGCCGTCCTGGCCGAGCACTGGTCACGGGGCGGGGCCGGGGCCGTGGACTTGGCTCGGGCGGTGGCGGCG
GCGGCGGAGATGCCCCGAGGCGAGCTCCGACTGACGTACGGCTTGCAAGGAAACACGGCGCTGGAGAGGATCGAG
GCCATCGCCAAGAAGCTGTACGGGGCCGATGGAGTGCAGCTCAGCGAACTGGCACGCACCAAGCTGGCGACGTAC
GAGAAGCAGGGCTACGGCGGCCTGCCCATCTGCATCGCCAAGACGCAGTACTCGCTGTCGCATGACGCGCAACTC
AAGGGCGCCCCGACGGGCTTTACGGTGCCGATCGGCGACGTGCGGCTGGCTGCTGGGGCGGGTTACCTATACGCG
CTGGCGGCGGACATACAGACGATGCCGGGCTTGCCGACGGCACCGGGCTACCTAAACATCGACGTCGACTGCTGT
ACGGGAGAGATCGACGGCTTGTTCTGA
Gene >Ophun1|4538
ATGGTCGCTACGAGGCTCGATGGCACTGCCCTTGCGCGACGCATTCGCGAGGGCATTGCGGCCGAGATTGTGCAG
AAGCAACAGGTGAATCCTCGGTACAAGCCGTTTTTTACCATTATTCAAGGTATCGTGAACGCGTCTCTTGTTGAT
GCCATGATATCATGATTGGACTTACATGTGTTTGCGCATTGCAGTGGGCGGTCGCTCTGATTCATGTGGGTGCTC
CCTCCCCTGACCTTGGCGAAATAGGAATAACGGGTGTGCAGCAACATATGTGCGCATGAAGCTCAAGGCCGCTCA
AGAGGTGAGACTCACCTTTCACGGAGCTGCAAGTATCCCGGCTCACCTTCTAGGCCGGTATCGGCTGCGAGCTGC
TGGCCTTGGACGAGTCCATCACTGAGTTTGAGCTCCTTGACCATATCCGCCGACTCAACCAGGATTCGGCCATCA
ACGGCATCCTGGTACAGTTGCCGCTTCCCGGCCACCTCTCGGAGCGCAACGTCACGTCGGCCGTGGCTGGCGAGA
AAGACGTCGATGGCTTCGGCACTGACAACATCGGCGAGCTCGCCAAGCGCGGCGGCAGCCCCGTATTCATCCCGT
GCACCCCCATGGGCGTCATGCTGCTCCTGGCCGAGGCTGGCGTCGAGGTCGCCGGTAAGTCGGCCGTGGTGTTGG
GCCGGAGCAACATCGTCGGCGGGCCCGTCAGTCATCTGCTGCGCAACGCAGACTGCACGGTGACCGTCTGTCACT
CCAAGACAAATGGGCTTCAGCGTTACCTCGCCGATGCCGACATCGTCGTCGCCGCCATCGGCCAGCCGCAGTTTA
TCAAGGGCGAGTGGCTCAAGGAGGGTGCCATCGTTATAGACGTCGGCACAAACTTCATCCCGGACGCCAGCAAGA
AGACGGGACAGCGGCTGGTGGGCGACGTCGACTTCGAGTCGGCGTCTCGCGTCGCCTCGGCCATCACTCCCGTCC
CCGGTGGCGTCGGACCCATGACGGTGGCCATGCTTCTCCGCAACGTCGTCGACGCCACCGACCGCTTCTTCGTGG
CGCAGAAGCGGCGTCGCATCGTGCCCCTGCCCCTGAAGCTCAGGGACCCGGTGCCGTCAGACAGCGCCATCTCGA
GGGAGCAGGTGCCCAAGCCCATCGTGGCCGTCGCCGAAGAGTTGGGAATCCCCCCGCACGAGCTGGAGCCGTACG
GCACCTACAAGGCCAAGATCCATCTCGGCCTCCTCGATAGGCTGGCGCATCGGCGGGACGGCCGCTACGTGGTGG
TGACGGGCATCACGCCCACGCCTCTGGGTGAGGGCAAGTCGACAACGACTGTCGGGTTGGCCCAGGCTTTGGGTG
CCCACCTCGGCCGGCTGACGTTTGCCAACGTGCGGCAGCCCAGCCAGGGGCCGACGTTTGGCATCAAGGGGGGCG
CTGCGGGCGGTGGCTACAGCCAGGTGACGCCCATGGACGAGTTCAACCTGCACCTCACGGGCGATATCCACGCCG
TGACGGCGGCCAACAACCTGCTGGCGGCGGCGCTCGAGTCGCGCATGTTCCACGAGCAGACACAAAAGGACGGGC
CGCTGTACCGGAGACTGGTGCCGGTCAAGGACGGCTCGCGCCGTTTCACGCCCGCCATGTTGCGGCGGCTGGCCC
GGCTGGGCATCGACAAGACGGATCCGGACGCGCTGACCGAGGACGAGGTCCGGCGCTTCGCCCGGCTCGACGTCG
ACCCGGACACCATTACGTGGAGGCGGGTGCTAGACGTCAACGACCGCCATCTCCGAGGCGTCACCGTCGGCACGG
CGGCCACGGAGAAGGGCCACTCTCGCCAGACGGGCTTCGACATCTCCGTCGCCAGCGAGTGCATGGCCATCCTGG
CCCTCAGCAACAGCCTGGGCGATATGCGCGACAGGCTGGGCCGCATGGTAGTGGCGACGTCGCTCAGAGGCGAGG
CTGTCACCTGCGACGACCTGGGGGCCACGGGAGCGCTGACGGCACTGATGAGGGACGCCATCAAGCCCAACCTGA
TGCAGACGCTCGAGGGGACGCCGGTGCTGGTGCACGCGGGCCCGTTTGCCAACATCAGCATCGGCCAGAGCTCCA
TTGTGGCAGACCGGCTGGCGCTCAAGCTGGCGGGCACGGAGGCGGACGAGGAGCCGACGGCGGCGGGCTTCGTCG
TGACCGAGGCGGGCTTCGACTTTACCATGGGCGGCGAGCGCTTCTTCAACATCAAGTGCCGGACTTCGGGCCTGG
TCCCGGACGTTGTTGTGGTGGTGGCGACGGTGAGGGCTCTCAAGGTGCACGGCGGTGGACCCCCGATCGCCCCGG
GAGCGCCGCTCGACGCCGTCTACAAGCGGGAGGACGTCGATCTGGTGCGGGCGGGCTGTGTCAACCTGCGGAAGC
ACATCACCAACGCGCGATCTTTTGGTGTGCCCGTCGTCGTGGCCATCAACCGGTTCGCGACGGACAGCCCGGCCG
AGGTGGCGGCGGTGCGGGAGGAGGCGACGGCTGCCGGGGCCGAAGATGCCGTCCTGGCCGAGCACTGGTCACGGG
GCGGGGCCGGGGCCGTGGACTTGGCTCGGGCGGTGGCGGCGGCGGCGGAGATGCCCCGAGGCGAGCTCCGACTGA
CGTACGGCTTGCAAGGAAACACGGCGCTGGAGAGGATCGAGGCCATCGCCAAGAAGCTGTACGGGGCCGATGGAG
TGCAGCTCAGCGAACTGGCACGCACCAAGCTGGCGACGTACGAGAAGCAGGGCTACGGCGGCCTGCCCATCTGCA
TCGCCAAGACGCAGTACTCGCTGTCGCATGACGCGCAACTCAAGGGCGCCCCGACGGGCTTTACGGTGCCGATCG
GCGACGTGCGGCTGGCTGCTGGGGCGGGTTACCTGTGAGTTTTACTGAAAAGGGGTGTGATGATGAAGGGTCCGG
CTGACGGCGTCGAGATACGCGCTGGCGGCGGACATACAGACGATGCCGGGCTTGCCGACGGCACCGGGCTACCTA
AACATCGACGTCGACTGCTGTACGGGAGAGATCGACGGCTTGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail