Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4534
Gene name
LocationContig_42:33573..36569
Strand+
Gene length (bp)2996
Transcript length (bp)2496
Coding sequence length (bp)2496
Protein length (aa) 832

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00632 HECT HECT-domain (ubiquitin-transferase) 4.2E-91 527 829
PF00397 WW WW domain 1.9E-10 233 262
PF00397 WW WW domain 1.1E-12 351 380
PF00397 WW WW domain 2.5E-10 410 439
PF00168 C2 C2 domain 1.1E-20 14 103

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CCL1|RSP5_ASPTN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hulA PE=3 SV=1 7 831 0.0E+00
sp|Q5BDP1|RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hulA PE=1 SV=1 7 831 0.0E+00
sp|Q2UBP1|RSP5_ASPOR Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hulA PE=3 SV=2 7 831 0.0E+00
sp|B8N7E5|RSP5_ASPFN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=hulA PE=3 SV=1 12 831 0.0E+00
sp|A1D3C5|RSP5_NEOFI Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hulA PE=3 SV=1 7 831 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CCL1|RSP5_ASPTN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hulA PE=3 SV=1 7 831 0.0E+00
sp|Q5BDP1|RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hulA PE=1 SV=1 7 831 0.0E+00
sp|Q2UBP1|RSP5_ASPOR Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hulA PE=3 SV=2 7 831 0.0E+00
sp|B8N7E5|RSP5_ASPFN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=hulA PE=3 SV=1 12 831 0.0E+00
sp|A1D3C5|RSP5_NEOFI Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hulA PE=3 SV=1 7 831 0.0E+00
sp|A2QQ28|RSP5_ASPNC Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hulA PE=3 SV=1 7 831 0.0E+00
sp|A1CQG2|RSP5_ASPCL Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hulA PE=3 SV=2 7 831 0.0E+00
sp|Q4WTF3|RSP5_ASPFU Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hulA PE=3 SV=2 7 831 0.0E+00
sp|B0XQ72|RSP5_ASPFC Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=hulA PE=3 SV=2 7 831 0.0E+00
sp|Q92462|PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub1 PE=1 SV=2 15 831 0.0E+00
sp|P39940|RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSP5 PE=1 SV=1 14 831 0.0E+00
sp|O14326|PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub3 PE=2 SV=1 11 831 0.0E+00
sp|Q8CFI0|NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus GN=Nedd4l PE=1 SV=2 197 828 0.0E+00
sp|Q96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens GN=NEDD4L PE=1 SV=2 170 828 0.0E+00
sp|Q8C863|ITCH_MOUSE E3 ubiquitin-protein ligase Itchy OS=Mus musculus GN=Itch PE=1 SV=2 5 831 0.0E+00
sp|Q5RBF2|NED4L_PONAB E3 ubiquitin-protein ligase NEDD4-like OS=Pongo abelii GN=NEDD4L PE=2 SV=1 233 828 0.0E+00
sp|Q96J02|ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens GN=ITCH PE=1 SV=2 5 831 0.0E+00
sp|Q9HCE7|SMUF1_HUMAN E3 ubiquitin-protein ligase SMURF1 OS=Homo sapiens GN=SMURF1 PE=1 SV=2 15 831 7.0E-175
sp|Q8BZZ3|WWP1_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Mus musculus GN=Wwp1 PE=1 SV=2 229 831 2.0E-174
sp|Q9H0M0|WWP1_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Homo sapiens GN=WWP1 PE=1 SV=1 229 831 2.0E-174
sp|O00308|WWP2_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens GN=WWP2 PE=1 SV=2 142 831 5.0E-174
sp|Q9DBH0|WWP2_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Mus musculus GN=Wwp2 PE=1 SV=1 37 831 2.0E-173
sp|P46934|NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens GN=NEDD4 PE=1 SV=4 233 828 1.0E-172
sp|A2A5Z6|SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus GN=Smurf2 PE=1 SV=1 233 831 1.0E-172
sp|P46935|NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus GN=Nedd4 PE=1 SV=3 236 828 2.0E-172
sp|Q9HAU4|SMUF2_HUMAN E3 ubiquitin-protein ligase SMURF2 OS=Homo sapiens GN=SMURF2 PE=1 SV=1 233 831 4.0E-172
sp|Q2TAS2|SMUF2_XENLA E3 ubiquitin-protein ligase SMURF2 OS=Xenopus laevis GN=smurf2 PE=2 SV=1 11 831 4.0E-171
sp|A9JRZ0|SMUF2_DANRE E3 ubiquitin-protein ligase SMURF2 OS=Danio rerio GN=smurf2 PE=2 SV=1 11 831 4.0E-171
sp|Q62940|NEDD4_RAT E3 ubiquitin-protein ligase NEDD4 OS=Rattus norvegicus GN=Nedd4 PE=1 SV=1 236 828 8.0E-171
sp|Q9Y0H4|SUDX_DROME E3 ubiquitin-protein ligase Su(dx) OS=Drosophila melanogaster GN=Su(dx) PE=1 SV=1 214 831 3.0E-167
sp|Q9UTG2|PUB2_SCHPO E3 ubiquitin-protein ligase pub2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub2 PE=1 SV=1 399 831 4.0E-159
sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster GN=Nedd4 PE=1 SV=2 314 829 2.0E-158
sp|Q9CUN6|SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus GN=Smurf1 PE=2 SV=2 348 831 3.0E-158
sp|Q9PUN2|SMUF1_XENLA E3 ubiquitin-protein ligase SMURF1 OS=Xenopus laevis GN=smurf1 PE=2 SV=1 348 831 2.0E-155
sp|Q9V853|SMUF1_DROME E3 ubiquitin-protein ligase Smurf1 OS=Drosophila melanogaster GN=lack PE=1 SV=3 439 831 1.0E-132
sp|Q6I6G8|HECW2_MOUSE E3 ubiquitin-protein ligase HECW2 OS=Mus musculus GN=Hecw2 PE=1 SV=1 452 831 4.0E-120
sp|Q9P2P5|HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens GN=HECW2 PE=1 SV=2 452 831 4.0E-120
sp|Q76N89|HECW1_HUMAN E3 ubiquitin-protein ligase HECW1 OS=Homo sapiens GN=HECW1 PE=1 SV=3 452 831 2.0E-116
sp|Q8K4P8|HECW1_MOUSE E3 ubiquitin-protein ligase HECW1 OS=Mus musculus GN=Hecw1 PE=1 SV=3 439 831 7.0E-116
sp|Q7Z6Z7|HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens GN=HUWE1 PE=1 SV=3 455 829 1.0E-105
sp|Q7TMY8|HUWE1_MOUSE E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus GN=Huwe1 PE=1 SV=5 455 829 2.0E-105
sp|Q9P4Z1|TOM1_NEUCR E3 ubiquitin-protein ligase TOM1-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11B22.010 PE=3 SV=4 476 822 1.0E-103
sp|Q756G2|TOM1_ASHGO Probable E3 ubiquitin-protein ligase TOM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TOM1 PE=3 SV=2 455 829 3.0E-100
sp|Q8GY23|UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana GN=UPL1 PE=1 SV=3 442 829 3.0E-98
sp|P51593|HUWE1_RAT E3 ubiquitin-protein ligase HUWE1 (Fragment) OS=Rattus norvegicus GN=Huwe1 PE=1 SV=2 512 829 4.0E-97
sp|Q8H0T4|UPL2_ARATH E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana GN=UPL2 PE=1 SV=3 455 829 1.0E-96
sp|O13834|PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr1 PE=1 SV=1 477 829 2.0E-96
sp|Q03280|TOM1_YEAST E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM1 PE=1 SV=1 478 829 9.0E-94
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 478 822 3.0E-84
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 478 822 1.0E-83
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 478 822 2.0E-83
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 478 822 2.0E-83
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 478 822 2.0E-82
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 478 822 2.0E-82
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 478 822 3.0E-82
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 478 822 3.0E-82
sp|Q8CDU6|HECD2_MOUSE Probable E3 ubiquitin-protein ligase HECTD2 OS=Mus musculus GN=Hectd2 PE=1 SV=2 464 831 3.0E-62
sp|Q5U5R9|HECD2_HUMAN Probable E3 ubiquitin-protein ligase HECTD2 OS=Homo sapiens GN=HECTD2 PE=2 SV=2 464 831 3.0E-62
sp|Q5RD78|HECD2_PONAB Probable E3 ubiquitin-protein ligase HECTD2 OS=Pongo abelii GN=HECTD2 PE=2 SV=1 464 831 5.0E-62
sp|O08759|UBE3A_MOUSE Ubiquitin-protein ligase E3A OS=Mus musculus GN=Ube3a PE=1 SV=2 478 829 4.0E-56
sp|Q05086|UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens GN=UBE3A PE=1 SV=4 478 829 1.0E-55
sp|Q8RWB8|UPL6_ARATH E3 ubiquitin-protein ligase UPL6 OS=Arabidopsis thaliana GN=UPL6 PE=2 SV=1 479 828 1.0E-50
sp|Q9SCQ2|UPL7_ARATH E3 ubiquitin-protein ligase UPL7 OS=Arabidopsis thaliana GN=UPL7 PE=2 SV=1 478 828 2.0E-48
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 478 828 2.0E-48
sp|Q9SU29|UPL5_ARATH E3 ubiquitin-protein ligase UPL5 OS=Arabidopsis thaliana GN=UPL5 PE=1 SV=1 480 830 7.0E-48
sp|Q1K9C4|YFK7_SCHPO Probable E3 ubiquitin protein ligase C167.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.07c PE=2 SV=1 477 829 1.0E-47
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 478 828 2.0E-47
sp|O15033|AREL1_HUMAN Apoptosis-resistant E3 ubiquitin protein ligase 1 OS=Homo sapiens GN=AREL1 PE=1 SV=3 456 829 5.0E-46
sp|Q8CHG5|AREL1_MOUSE Apoptosis-resistant E3 ubiquitin protein ligase 1 OS=Mus musculus GN=Arel1 PE=2 SV=2 456 829 8.0E-46
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 478 828 2.0E-45
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 478 828 1.0E-43
sp|Q757T0|HUL4_ASHGO Probable E3 ubiquitin-protein ligase HUL4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HUL4 PE=3 SV=1 444 829 2.0E-43
sp|P40985|HUL4_YEAST Probable E3 ubiquitin-protein ligase HUL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HUL4 PE=1 SV=2 478 829 3.0E-41
sp|Q08CZ0|UBE3B_XENTR Ubiquitin-protein ligase E3B OS=Xenopus tropicalis GN=ube3b PE=2 SV=1 477 828 7.0E-41
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 478 829 8.0E-41
sp|Q7Z3V4|UBE3B_HUMAN Ubiquitin-protein ligase E3B OS=Homo sapiens GN=UBE3B PE=1 SV=3 477 828 2.0E-40
sp|Q9ES34|UBE3B_MOUSE Ubiquitin-protein ligase E3B OS=Mus musculus GN=Ube3b PE=1 SV=3 477 828 3.0E-40
sp|Q80U95|UBE3C_MOUSE Ubiquitin-protein ligase E3C OS=Mus musculus GN=Ube3c PE=1 SV=2 477 828 5.0E-39
sp|Q15386|UBE3C_HUMAN Ubiquitin-protein ligase E3C OS=Homo sapiens GN=UBE3C PE=1 SV=3 477 828 6.0E-39
sp|P53119|HUL5_YEAST Probable E3 ubiquitin-protein ligase HUL5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HUL5 PE=1 SV=1 480 822 1.0E-35
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 478 828 3.0E-35
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 490 822 5.0E-33
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 478 828 5.0E-32
sp|O94275|MUG30_SCHPO Probable E3 ubiquitin-protein ligase mug30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug30 PE=1 SV=1 478 828 6.0E-32
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 485 822 2.0E-29
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 507 822 1.0E-28
sp|Q14669|TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens GN=TRIP12 PE=1 SV=1 566 824 2.0E-25
sp|F1RCR6|TRIPC_DANRE E3 ubiquitin-protein ligase TRIP12 OS=Danio rerio GN=trip12 PE=3 SV=1 566 824 3.0E-25
sp|E1B7Q7|TRIPC_BOVIN E3 ubiquitin-protein ligase TRIP12 OS=Bos taurus GN=TRIP12 PE=2 SV=2 566 824 4.0E-25
sp|F1LP64|TRIPC_RAT E3 ubiquitin-protein ligase TRIP12 OS=Rattus norvegicus GN=Trip12 PE=1 SV=1 566 824 4.0E-25
sp|G5E870|TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus GN=Trip12 PE=1 SV=1 505 824 7.0E-25
sp|B4F6W9|TRIPC_XENTR E3 ubiquitin-protein ligase TRIP12 OS=Xenopus tropicalis GN=trip12 PE=2 SV=1 566 824 1.0E-24
sp|Q9LYZ7|UPL4_ARATH E3 ubiquitin-protein ligase UPL4 OS=Arabidopsis thaliana GN=UPL4 PE=3 SV=1 563 827 2.0E-24
sp|Q6WWW4|UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis thaliana GN=UPL3 PE=1 SV=1 478 827 2.0E-23
sp|Q3U487|HECD3_MOUSE E3 ubiquitin-protein ligase HECTD3 OS=Mus musculus GN=Hectd3 PE=1 SV=2 498 821 2.0E-22
sp|P51592|HYD_DROME E3 ubiquitin-protein ligase hyd OS=Drosophila melanogaster GN=hyd PE=1 SV=3 561 828 3.0E-22
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 486 822 2.0E-21
sp|Q5T447|HECD3_HUMAN E3 ubiquitin-protein ligase HECTD3 OS=Homo sapiens GN=HECTD3 PE=1 SV=1 498 821 2.0E-21
sp|Q1L8J7|YAP1_DANRE Transcriptional coactivator YAP1 OS=Danio rerio GN=yap1 PE=2 SV=2 332 504 9.0E-21
sp|Q80TP3|UBR5_MOUSE E3 ubiquitin-protein ligase UBR5 OS=Mus musculus GN=Ubr5 PE=1 SV=2 554 829 1.0E-20
sp|Q9V853|SMUF1_DROME E3 ubiquitin-protein ligase Smurf1 OS=Drosophila melanogaster GN=lack PE=1 SV=3 11 301 2.0E-20
sp|O95071|UBR5_HUMAN E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens GN=UBR5 PE=1 SV=2 554 829 2.0E-20
sp|Q62671|UBR5_RAT E3 ubiquitin-protein ligase UBR5 OS=Rattus norvegicus GN=Ubr5 PE=1 SV=3 554 829 2.0E-20
sp|P33202|UFD4_YEAST Ubiquitin fusion degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD4 PE=1 SV=1 552 827 9.0E-20
sp|Q8SSY6|SPKUL_DICDI Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase OS=Dictyostelium discoideum GN=DDB_G0276527 PE=3 SV=2 566 829 9.0E-19
sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster GN=Nedd4 PE=1 SV=2 14 343 2.0E-18
sp|Q10435|YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.01c PE=3 SV=2 396 827 1.0E-17
sp|Q9CUN6|SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus GN=Smurf1 PE=2 SV=2 15 262 8.0E-17
sp|Q9PUN2|SMUF1_XENLA E3 ubiquitin-protein ligase SMURF1 OS=Xenopus laevis GN=smurf1 PE=2 SV=1 15 262 2.0E-16
sp|Q9ULT8|HECD1_HUMAN E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens GN=HECTD1 PE=1 SV=3 643 824 2.0E-16
sp|Q2EJA0|YAP1_RAT Transcriptional coactivator YAP1 OS=Rattus norvegicus GN=Yap1 PE=1 SV=1 346 441 7.0E-16
sp|D6C652|YAP1A_XENLA Transcriptional coactivator YAP1-A OS=Xenopus laevis GN=yap1-a PE=1 SV=1 346 441 1.0E-15
sp|P46938|YAP1_MOUSE Transcriptional coactivator YAP1 OS=Mus musculus GN=Yap1 PE=1 SV=2 346 441 1.0E-15
sp|H2LBU8|YAP1_ORYLA Transcriptional coactivator YAP1 OS=Oryzias latipes GN=yap1 PE=1 SV=2 329 441 1.0E-15
sp|P46937|YAP1_HUMAN Transcriptional coactivator YAP1 OS=Homo sapiens GN=YAP1 PE=1 SV=2 333 441 5.0E-15
sp|Q69ZR2|HECD1_MOUSE E3 ubiquitin-protein ligase HECTD1 OS=Mus musculus GN=Hectd1 PE=1 SV=2 643 824 7.0E-15
sp|Q45VV3|YAP1_DROME Transcriptional coactivator yorkie OS=Drosophila melanogaster GN=yki PE=1 SV=2 349 445 3.0E-13
sp|C6KTB7|ALTH1_PLAF7 Putative E3 ubiquitin-protein ligase protein PFF1365c OS=Plasmodium falciparum (isolate 3D7) GN=PFF1365c PE=3 SV=1 558 823 4.0E-12
sp|Q6I6G8|HECW2_MOUSE E3 ubiquitin-protein ligase HECW2 OS=Mus musculus GN=Hecw2 PE=1 SV=1 233 381 7.0E-12
sp|Q9P2P5|HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens GN=HECW2 PE=1 SV=2 233 381 7.0E-12
sp|H2LBU8|YAP1_ORYLA Transcriptional coactivator YAP1 OS=Oryzias latipes GN=yap1 PE=1 SV=2 233 411 7.0E-11
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 350 475 1.0E-10
sp|Q8IX03|KIBRA_HUMAN Protein KIBRA OS=Homo sapiens GN=WWC1 PE=1 SV=1 351 441 2.0E-10
sp|Q5SXA9|KIBRA_MOUSE Protein KIBRA OS=Mus musculus GN=Wwc1 PE=1 SV=1 351 441 2.0E-10
sp|A4IIJ3|KIBRA_XENTR Protein KIBRA OS=Xenopus tropicalis GN=wwc1 PE=2 SV=1 351 441 4.0E-10
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 350 475 4.0E-10
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 350 475 6.0E-10
sp|Q6AWC2|WWC2_HUMAN Protein WWC2 OS=Homo sapiens GN=WWC2 PE=1 SV=2 347 493 1.0E-09
sp|Q6RHR9|MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus GN=Magi1 PE=1 SV=1 349 441 1.0E-09
sp|Q96QZ7|MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens GN=MAGI1 PE=1 SV=3 349 441 2.0E-09
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 350 475 3.0E-09
sp|Q4L1J4|MAGI1_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Rattus norvegicus GN=Magi1 PE=1 SV=1 349 441 3.0E-09
sp|Q1L8J7|YAP1_DANRE Transcriptional coactivator YAP1 OS=Danio rerio GN=yap1 PE=2 SV=2 233 412 4.0E-09
sp|Q6NXJ0|WWC2_MOUSE Protein WWC2 OS=Mus musculus GN=Wwc2 PE=1 SV=1 347 493 5.0E-09
sp|A1A5G4|MAGI3_XENTR Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Xenopus tropicalis GN=magi3 PE=2 SV=1 351 441 7.0E-09
sp|Q5F488|MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus GN=MAGI3 PE=2 SV=1 351 441 3.0E-08
sp|Q6DJR2|WWC2_XENTR Protein WWC2 OS=Xenopus tropicalis GN=wwc2 PE=2 SV=1 347 440 4.0E-08
sp|Q9FIK8|CAR11_ARATH Protein C2-DOMAIN ABA-RELATED 11 OS=Arabidopsis thaliana GN=CAR11 PE=1 SV=1 15 90 5.0E-08
sp|Q9JK71|MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus GN=Magi3 PE=1 SV=2 351 439 8.0E-08
sp|O88382|MAGI2_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus GN=Magi2 PE=1 SV=1 338 441 8.0E-08
sp|Q9EQJ9|MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus GN=Magi3 PE=1 SV=2 351 439 8.0E-08
sp|Q5TCQ9|MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens GN=MAGI3 PE=1 SV=2 407 441 8.0E-08
sp|Q9JK71|MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus GN=Magi3 PE=1 SV=2 407 441 9.0E-08
sp|Q9EQJ9|MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus GN=Magi3 PE=1 SV=2 407 441 9.0E-08
sp|Q5F488|MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus GN=MAGI3 PE=2 SV=1 407 441 1.0E-07
sp|Q9WVQ1|MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Mus musculus GN=Magi2 PE=1 SV=2 348 441 2.0E-07
sp|Q9H4B6|SAV1_HUMAN Protein salvador homolog 1 OS=Homo sapiens GN=SAV1 PE=1 SV=2 323 452 2.0E-07
sp|Q8CFI0|NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus GN=Nedd4l PE=1 SV=2 15 98 3.0E-07
sp|Q96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens GN=NEDD4L PE=1 SV=2 15 98 3.0E-07
sp|Q6RHR9|MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus GN=Magi1 PE=1 SV=1 407 441 3.0E-07
sp|Q96QZ7|MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens GN=MAGI1 PE=1 SV=3 407 441 3.0E-07
sp|Q86UL8|MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens GN=MAGI2 PE=1 SV=3 338 441 3.0E-07
sp|Q5RBF2|NED4L_PONAB E3 ubiquitin-protein ligase NEDD4-like OS=Pongo abelii GN=NEDD4L PE=2 SV=1 15 98 4.0E-07
sp|A1A5G4|MAGI3_XENTR Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Xenopus tropicalis GN=magi3 PE=2 SV=1 407 441 5.0E-07
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 350 475 5.0E-07
sp|Q76N89|HECW1_HUMAN E3 ubiquitin-protein ligase HECW1 OS=Homo sapiens GN=HECW1 PE=1 SV=3 217 346 7.0E-07
sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 15 98 7.0E-07
sp|A4V8B4|SAV1_RAT Protein salvador homolog 1 OS=Rattus norvegicus GN=Sav1 PE=2 SV=1 323 452 7.0E-07
sp|Q4L1J4|MAGI1_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Rattus norvegicus GN=Magi1 PE=1 SV=1 407 441 8.0E-07
sp|Q19404|YAP1_CAEEL Yes-associated protein homolog 1 OS=Caenorhabditis elegans GN=yap-1 PE=1 SV=2 402 441 2.0E-06
sp|Q8VEB2|SAV1_MOUSE Protein salvador homolog 1 OS=Mus musculus GN=Sav1 PE=1 SV=2 327 452 2.0E-06
sp|Q7XA06|SYT3_ARATH Synaptotagmin-3 OS=Arabidopsis thaliana GN=SYT3 PE=2 SV=1 15 90 3.0E-06
sp|B4K6I9|KIBRA_DROMO Protein kibra OS=Drosophila mojavensis GN=Kibra PE=3 SV=1 351 440 3.0E-06
sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster GN=Nedd4 PE=1 SV=2 214 265 4.0E-06
sp|Q5R4J5|SYT1_PONAB Synaptotagmin-1 OS=Pongo abelii GN=SYT1 PE=2 SV=1 9 89 4.0E-06
sp|O95817|BAG3_HUMAN BAG family molecular chaperone regulator 3 OS=Homo sapiens GN=BAG3 PE=1 SV=3 409 450 4.0E-06
sp|B4M5X4|KIBRA_DROVI Protein kibra OS=Drosophila virilis GN=Kibra PE=3 SV=1 351 440 7.0E-06
sp|Q2EJA0|YAP1_RAT Transcriptional coactivator YAP1 OS=Rattus norvegicus GN=Yap1 PE=1 SV=1 409 451 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0004842 ubiquitin-protein transferase activity Yes
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1751
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2408
Ophiocordyceps australis map64 (Brazil) OphauB2|7742
Ophiocordyceps camponoti-floridani Ophcf2|00948
Ophiocordyceps camponoti-rufipedis Ophun1|4534 (this protein)
Ophiocordyceps kimflemingae Ophio5|2154
Ophiocordyceps subramaniannii Hirsu2|1629

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4534
MAGRSESGLPGKPNLRVTIIAADGLYKRDVFRLPDPFAVATINGEQTKTTTVSKRTLNPYWNESFDFRVNEDSIL
AVQVFDQKKFKKKDQGFLGVINIRVGDVMHALGADADDQMLTRDLKKSTDNLVVHGKLIINLSCNLTAPARGGQS
SSSRPPLSNQGATSASSLSASMGDNRPGSSMSGQNGAVNGAQTTLPHHPASSTSTPNPTASNGSGQSRPMSQLSP
FEDNQGRLPAGWERREDNLGRTYYVDHNTRTTSWNRPTASGAAESRSDREAATQVERQRHQNRTLPEDRTGTSSP
TLQQQQQGQAQAQSQPHASTNSNSNNNAAGAGAANTTMMHTGATSPGSGELPSGWEQRWTPEGRPYFVDHNTRTT
TWVDPRRQQYIRMYGGQNNANGQIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVP
QYKRDFRRKLIYFRSQPAMRILSGQCHIKVRRSHIFEDSFAEITRQSPMDLKKRLMIKFDGEDGLDYGGLSREFF
FLLSHEMFNPFYCLFEYSAHDNYTLQINPHSGINPEHLNYFKFIGRVVGLAIFHRRFLDAFFIGALYKMVLGKAV
TLADMEGVDADFHRSLQWMLDNDISGGILEQTFSTEDERFGVMTTEDLIPNGRNIDVTNENKKEYVDLMVKWRIE
KRIAEQFQAFKEGFQELIPQDLINVFDERELELLIGGIAEIDVDDWKKHTDYRGYTESDEVIQNFWQTVRSWDGE
QKSRLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEITNLPKAHTCFNRIDLPPYKNMETLQQKLTIAVEET
MGFGQE*
Coding >Ophun1|4534
ATGGCTGGCCGATCCGAGTCTGGCCTGCCCGGCAAGCCTAACCTGCGCGTCACAATCATCGCCGCCGATGGCCTC
TACAAGAGAGACGTCTTCCGTCTGCCCGACCCCTTTGCCGTGGCCACCATCAACGGCGAGCAGACCAAGACAACG
ACGGTCAGCAAACGAACGCTGAACCCGTACTGGAACGAGAGCTTTGACTTCCGTGTCAACGAGGACAGCATCCTG
GCTGTCCAGGTCTTCGATCAGAAAAAGTTTAAGAAGAAGGACCAGGGCTTCCTCGGCGTCATCAACATCAGAGTT
GGTGATGTCATGCACGCTCTTGGAGCCGATGCCGATGATCAGATGCTCACGCGCGACCTAAAAAAGTCGACTGAC
AATCTCGTCGTACACGGAAAGCTTATCATTAACCTCTCCTGCAACCTGACCGCACCGGCTCGTGGCGGCCAGTCG
TCGAGCAGTCGTCCGCCCCTCTCCAATCAGGGCGCCACCAGTGCGTCCTCGCTCTCCGCCTCGATGGGCGATAAC
CGTCCCGGCTCGTCCATGTCCGGCCAGAATGGCGCCGTCAACGGAGCTCAGACCACGCTGCCTCACCATCCCGCC
AGCTCCACCTCCACTCCGAACCCTACCGCCTCGAACGGCTCAGGCCAATCCCGGCCAATGAGTCAGCTCAGCCCC
TTCGAGGACAATCAGGGTCGCCTGCCGGCTGGCTGGGAGCGACGCGAAGACAACCTCGGCCGCACCTACTACGTG
GATCACAACACGCGAACTACCAGCTGGAATCGGCCGACGGCCAGCGGCGCAGCCGAGTCACGCAGCGACAGGGAG
GCGGCAACGCAGGTCGAGCGCCAGAGACACCAAAACCGGACCTTGCCGGAAGATAGGACCGGCACCAGTTCGCCG
ACCCTACAGCAGCAGCAGCAGGGTCAGGCGCAGGCCCAGTCGCAGCCTCATGCCAGCACCAACAGCAACAGCAAC
AACAACGCTGCCGGCGCCGGCGCCGCCAATACGACCATGATGCACACTGGCGCCACCAGCCCCGGCTCTGGCGAG
CTACCTTCTGGTTGGGAACAGCGATGGACACCCGAGGGCAGGCCCTACTTCGTCGATCACAACACGCGAACGACG
ACATGGGTCGACCCTCGCCGTCAGCAATACATTCGCATGTACGGAGGGCAGAACAACGCAAACGGTCAGATACAG
CAGCAGCCCGTTTCGCAGCTCGGGCCCCTTCCCAGCGGTTGGGAGATGCGACTCACCAATACTGCTCGCGTCTAC
TTTGTTGACCACAATACCAAGACGACCACTTGGGACGATCCTCGCCTACCGTCCTCCCTTGATCAGAACGTGCCT
CAGTACAAGCGCGACTTCCGGCGGAAGCTGATTTACTTCCGGTCTCAGCCCGCGATGCGCATCCTTAGCGGGCAG
TGTCACATCAAAGTCCGGCGATCGCACATCTTTGAGGATTCCTTTGCCGAAATCACCCGACAATCTCCCATGGAC
CTCAAGAAGCGACTGATGATCAAGTTTGACGGAGAAGACGGTCTGGACTACGGCGGCCTGTCTCGAGAGTTCTTC
TTCCTCCTGTCACACGAGATGTTCAACCCCTTTTACTGCCTGTTCGAGTACTCGGCGCACGACAACTATACGCTG
CAGATCAACCCCCACTCTGGCATCAACCCGGAGCACTTGAACTACTTCAAGTTCATCGGGCGTGTCGTCGGTCTG
GCCATCTTCCACCGGCGTTTCCTGGATGCCTTCTTCATTGGCGCCCTCTACAAGATGGTTCTGGGCAAGGCGGTG
ACCCTGGCAGACATGGAAGGCGTCGACGCCGACTTCCATCGTTCGCTCCAGTGGATGCTGGACAACGACATCTCT
GGCGGCATTCTGGAGCAGACCTTTTCCACCGAAGACGAGAGGTTCGGAGTCATGACCACGGAGGATCTCATCCCC
AACGGTCGGAACATTGATGTCACAAACGAGAACAAAAAGGAGTACGTCGACCTCATGGTCAAGTGGCGCATTGAG
AAGCGCATCGCGGAGCAGTTCCAGGCCTTCAAAGAGGGTTTCCAAGAGCTCATTCCTCAAGACCTCATCAACGTC
TTTGACGAGCGCGAACTCGAGCTCCTCATTGGCGGTATCGCCGAGATTGACGTTGACGACTGGAAGAAGCATACC
GACTACCGAGGCTACACCGAGTCGGACGAGGTCATTCAGAACTTCTGGCAGACCGTCCGCTCATGGGACGGCGAG
CAGAAGTCGCGGCTTCTGCAGTTCACGACGGGCACCTCGAGAATCCCGGTCAACGGGTTCAAAGACCTGCAGGGC
AGCGACGGTCCTCGGCGTTTTACCATTGAAAAGGCGGGAGAGATAACGAACCTTCCGAAAGCACACACTTGCTTC
AACCGAATCGATCTTCCTCCATATAAGAATATGGAGACTCTGCAACAAAAGCTCACAATCGCCGTGGAAGAGACC
ATGGGCTTCGGTCAGGAATAA
Transcript >Ophun1|4534
ATGGCTGGCCGATCCGAGTCTGGCCTGCCCGGCAAGCCTAACCTGCGCGTCACAATCATCGCCGCCGATGGCCTC
TACAAGAGAGACGTCTTCCGTCTGCCCGACCCCTTTGCCGTGGCCACCATCAACGGCGAGCAGACCAAGACAACG
ACGGTCAGCAAACGAACGCTGAACCCGTACTGGAACGAGAGCTTTGACTTCCGTGTCAACGAGGACAGCATCCTG
GCTGTCCAGGTCTTCGATCAGAAAAAGTTTAAGAAGAAGGACCAGGGCTTCCTCGGCGTCATCAACATCAGAGTT
GGTGATGTCATGCACGCTCTTGGAGCCGATGCCGATGATCAGATGCTCACGCGCGACCTAAAAAAGTCGACTGAC
AATCTCGTCGTACACGGAAAGCTTATCATTAACCTCTCCTGCAACCTGACCGCACCGGCTCGTGGCGGCCAGTCG
TCGAGCAGTCGTCCGCCCCTCTCCAATCAGGGCGCCACCAGTGCGTCCTCGCTCTCCGCCTCGATGGGCGATAAC
CGTCCCGGCTCGTCCATGTCCGGCCAGAATGGCGCCGTCAACGGAGCTCAGACCACGCTGCCTCACCATCCCGCC
AGCTCCACCTCCACTCCGAACCCTACCGCCTCGAACGGCTCAGGCCAATCCCGGCCAATGAGTCAGCTCAGCCCC
TTCGAGGACAATCAGGGTCGCCTGCCGGCTGGCTGGGAGCGACGCGAAGACAACCTCGGCCGCACCTACTACGTG
GATCACAACACGCGAACTACCAGCTGGAATCGGCCGACGGCCAGCGGCGCAGCCGAGTCACGCAGCGACAGGGAG
GCGGCAACGCAGGTCGAGCGCCAGAGACACCAAAACCGGACCTTGCCGGAAGATAGGACCGGCACCAGTTCGCCG
ACCCTACAGCAGCAGCAGCAGGGTCAGGCGCAGGCCCAGTCGCAGCCTCATGCCAGCACCAACAGCAACAGCAAC
AACAACGCTGCCGGCGCCGGCGCCGCCAATACGACCATGATGCACACTGGCGCCACCAGCCCCGGCTCTGGCGAG
CTACCTTCTGGTTGGGAACAGCGATGGACACCCGAGGGCAGGCCCTACTTCGTCGATCACAACACGCGAACGACG
ACATGGGTCGACCCTCGCCGTCAGCAATACATTCGCATGTACGGAGGGCAGAACAACGCAAACGGTCAGATACAG
CAGCAGCCCGTTTCGCAGCTCGGGCCCCTTCCCAGCGGTTGGGAGATGCGACTCACCAATACTGCTCGCGTCTAC
TTTGTTGACCACAATACCAAGACGACCACTTGGGACGATCCTCGCCTACCGTCCTCCCTTGATCAGAACGTGCCT
CAGTACAAGCGCGACTTCCGGCGGAAGCTGATTTACTTCCGGTCTCAGCCCGCGATGCGCATCCTTAGCGGGCAG
TGTCACATCAAAGTCCGGCGATCGCACATCTTTGAGGATTCCTTTGCCGAAATCACCCGACAATCTCCCATGGAC
CTCAAGAAGCGACTGATGATCAAGTTTGACGGAGAAGACGGTCTGGACTACGGCGGCCTGTCTCGAGAGTTCTTC
TTCCTCCTGTCACACGAGATGTTCAACCCCTTTTACTGCCTGTTCGAGTACTCGGCGCACGACAACTATACGCTG
CAGATCAACCCCCACTCTGGCATCAACCCGGAGCACTTGAACTACTTCAAGTTCATCGGGCGTGTCGTCGGTCTG
GCCATCTTCCACCGGCGTTTCCTGGATGCCTTCTTCATTGGCGCCCTCTACAAGATGGTTCTGGGCAAGGCGGTG
ACCCTGGCAGACATGGAAGGCGTCGACGCCGACTTCCATCGTTCGCTCCAGTGGATGCTGGACAACGACATCTCT
GGCGGCATTCTGGAGCAGACCTTTTCCACCGAAGACGAGAGGTTCGGAGTCATGACCACGGAGGATCTCATCCCC
AACGGTCGGAACATTGATGTCACAAACGAGAACAAAAAGGAGTACGTCGACCTCATGGTCAAGTGGCGCATTGAG
AAGCGCATCGCGGAGCAGTTCCAGGCCTTCAAAGAGGGTTTCCAAGAGCTCATTCCTCAAGACCTCATCAACGTC
TTTGACGAGCGCGAACTCGAGCTCCTCATTGGCGGTATCGCCGAGATTGACGTTGACGACTGGAAGAAGCATACC
GACTACCGAGGCTACACCGAGTCGGACGAGGTCATTCAGAACTTCTGGCAGACCGTCCGCTCATGGGACGGCGAG
CAGAAGTCGCGGCTTCTGCAGTTCACGACGGGCACCTCGAGAATCCCGGTCAACGGGTTCAAAGACCTGCAGGGC
AGCGACGGTCCTCGGCGTTTTACCATTGAAAAGGCGGGAGAGATAACGAACCTTCCGAAAGCACACACTTGCTTC
AACCGAATCGATCTTCCTCCATATAAGAATATGGAGACTCTGCAACAAAAGCTCACAATCGCCGTGGAAGAGACC
ATGGGCTTCGGTCAGGAATAA
Gene >Ophun1|4534
ATGGCTGGCCGATCCGAGTCTGGCCTGCCCGGGTGAGCATCATCGTCATCGTCTGCTGATTGCGTGCTTGCTAAC
TACCTACCTCTCACGCAGCAAGCCTAACCTGCGCGTCACAAGTTCGTTTTCCCTCACTGCCTTGCCTTGCCTTTG
CCTCTCTTTGTCTCTTCTGCCTTTTCATCATCTCCCCTCGCCGCTGCCCTTCATCAACCAACCCCCGGTCGCGCC
TTCATCTTTACTGACGCCACATCAGTCATCGCCGCCGATGGCCTCTACAAGAGAGACGTCTTCCGTCCGTGCTCC
CCCTTCCTACCTGCTCAAGGGTTGCCGAATATCCTAAGCAACGCCGCTGACGACCTCTCCAGGTCTGCCCGACCC
CTTTGCCGTGGCCACCATCAACGGCGAGCAGACCAAGACAACGACGGTCAGCAAACGAACGCTGAACCCGTACTG
GAACGAGAGCTTTGACTTGTAGGAGGCCCCCCGCCTTTCCGCTTCTCCTGCTGGGGCTTACTTTCTTCCTTTTCG
CCGCAGCCGTGTCAACGAGGACAGCATCCTGGCTGTCCAGGTCTTCGATCAGAAAAAGTTTAAGAAGAAGGACCA
GGGCTTCCTCGGCGTCATCAACATCAGAGTTGGTGATGTCATGCACGCTCTTGGAGCCGATGCCGATGGTACGCC
GTCATGCCTCGTCTGCGGCCTCGAACCTTGCCTGTCCCCCGGCTTCCGTTGGCCGCTAGACGCCGTGGCCAAAGC
CAGCTTCGCTAATTGTTCAATCGTATAGATCAGATGCTCACGCGCGACCTAAAAAAGTCGACTGACAATCTCGTC
GTACACGGAAAGCTTATCATTAACCTCTCCTGCAACCTGACCGCACCGGCTCGTGGCGGCCAGTCGTCGAGCAGT
CGTCCGCCCCTCTCCAATCAGGGCGCCACCAGTGCGTCCTCGCTCTCCGCCTCGATGGGCGATAACCGTCCCGGC
TCGTCCATGTCCGGCCAGAATGGCGCCGTCAACGGAGCTCAGACCACGCTGCCTCACCATCCCGCCAGCTCCACC
TCCACTCCGAACCCTACCGCCTCGAACGGCTCAGGCCAATCCCGGCCAATGAGTCAGCTCAGCCCCTTCGAGGAC
AATCAGGGTCGCCTGCCGGCTGGCTGGGAGCGACGCGAAGACAACCTCGGCCGCACCTACTACGTGGATCACAAC
ACGCGAACTACCAGCTGGAATCGGCCGACGGCCAGCGGCGCAGCCGAGTCACGCAGCGACAGGGAGGCGGCAACG
CAGGTCGAGCGCCAGAGACACCAAAACCGGACCTTGCCGGAAGATAGGACCGGCACCAGTTCGCCGACCCTACAG
CAGCAGCAGCAGGGTCAGGCGCAGGCCCAGTCGCAGCCTCATGCCAGCACCAACAGCAACAGCAACAACAACGCT
GCCGGCGCCGGCGCCGCCAATACGACCATGATGCACACTGGCGCCACCAGCCCCGGCTCTGGCGAGCTACCTTCT
GGTTGGGAACAGCGATGGACACCCGAGGGCAGGCCCTACTTCGTCGATCACAACACGCGAACGACGACATGGGTC
GACCCTCGCCGTCAGCAATACATTCGCATGTACGGAGGGCAGAACAACGCAAACGGTCAGATACAGCAGCAGCCC
GTTTCGCAGCTCGGGCCCCTTCCCAGCGGTTGGGAGATGCGACTCACCAATACTGCTCGCGTCTACTTTGTTGAC
CACAATACCAAGACGACCACTTGGGACGATCCTCGCCTACCGTCCTCCCTTGATCAGAACGTGCCTCAGTACAAG
CGCGACTTCCGGCGGAAGCTGATTTACTTCCGGTCTCAGCCCGCGATGCGCATCCTTAGCGGGCAGTGTCACATC
AAAGTCCGGCGATCGCACATCTTTGAGGATTCCTTTGCCGAAATCACCCGACAATCTCCCATGGACCTCAAGAAG
CGACTGATGATCAAGTTTGACGGAGAAGACGGTCTGGACTACGGCGGCCTGTCTCGAGAGTTCTTCTTCCTCCTG
TCACACGAGATGTTCAACCCCTTTTACTGCCTGTTCGAGTACTCGGCGCACGACAACTATACGCTGCAGATCAAC
CCCCACTCTGGCATCAACCCGGAGCACTTGAACTACTTCAAGTTCATCGGGCGTGTCGTCGGTCTGGCCATCTTC
CACCGGCGTTTCCTGGATGCCTTCTTCATTGGCGCCCTCTACAAGATGGTTCTGGGCAAGGCGGTGACCCTGGCA
GACATGGAAGGCGTCGACGCCGACTTCCATCGTTCGCTCCAGTGGATGCTGGACAACGACATCTCTGGCGGCATT
CTGGAGCAGACCTTTTCCACCGAAGACGAGAGGTTCGGAGTCATGACCACGGAGGATCTCATCCCCAACGGTCGG
AACATTGATGTCACAAACGAGAACAAAAAGGAGTACGTCGACCTCATGGTCAAGTGGCGCATTGAGAAGCGCATC
GCGGAGCAGTTCCAGGCCTTCAAAGAGGGTTTCCAAGAGCTCATTCCTCAAGACCTCATCAACGTCTTTGACGAG
CGCGAACTCGAGCTCCTCATTGGCGGTATCGCCGAGATTGACGTTGACGACTGGAAGAAGCATACCGACTACCGA
GGCTACACCGAGTCGGACGAGGTCATTCAGAACTTCTGGCAGACCGTCCGCTCATGGGACGGCGAGCAGAAGTCG
CGGCTTCTGCAGTTCACGACGGGCACCTCGAGAATCCCGGTCAACGGGTTCAAAGACCTGCAGGGCAGCGACGGT
CCTCGGCGTTTTACCATTGAAAAGGCGGGAGAGATAACGAACCTTCCGAAAGCACACACTTGGTAAGTCTCGGAC
GGGCTCGGGGGACCAGAGTGTCGGCTTCGACTAACGGCTTGTACAGCTTCAACCGAATCGATCTTCCTCCATATA
AGAATATGGAGACTCTGCAACAAAAGCTCACAATCGCCGTGGAAGAGACCATGGGCTTCGGTCAGGAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail