Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4528
Gene name
LocationContig_42:20674..22456
Strand-
Gene length (bp)1782
Transcript length (bp)1782
Coding sequence length (bp)1782
Protein length (aa) 594

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05686 Glyco_transf_90 Glycosyl transferase family 90 2.4E-09 456 577

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5K8R6|CXT1_CRYNJ Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CXT1 PE=1 SV=1 40 584 6.0E-40
sp|Q29AU6|RUMI_DROPS O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura GN=rumi PE=3 SV=1 455 577 1.0E-08
sp|Q8T045|RUMI_DROME O-glucosyltransferase rumi OS=Drosophila melanogaster GN=rumi PE=1 SV=1 456 573 8.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4528
MHKMRPERRLWPLRLAIRYLTVALLVSLALLNFLLWHQTQLPFGRRHPIQRLMAEAEARSRVLMARRSLDLATAA
ARYRHRRRRHPPPGFDDWFRAAAEADAVVVEDFFDRIYKDVTPFWALSPSSIRRRATAWHWVVRVRNGTASPQGN
VEGRVPWLQLWTSLVSEFASKLPDVDMPINMLDEARLLVPHADMARLVAKAESETTMTDPDLTSSRFSGLADVDD
DRPPLYEPPWFGPGNSYWNLAAKTCGPDTPAHGVRQIRDFAPPAELPPDWRPPYALEGFVQNWTAAMDPCLQPHL
RQLHGTFIEPLSLSSTDELIPIFGGSKLPMNSEILIPGAMYLTDDTFYSGGEAHGPAWPDKKDGLIWRGDASGGR
TKEHSWHHFQRHRLVDMLNGTTVSRLESAGVRAPTFSLPSTSLYRRRRQLGAWIARFADAAFVHLCPPGECDFVS
PYFRPSDQVPMETQYQHKFLPDADGNSFSARFRGFLRSTSLPIKATIYAEWHDDRLIPWLHFVPMDNTFQDLYAL
LDFFAPGGSLNNRGDAAARLIAERGRDWAETVLRREDMRLYVWRLLLEWARVCDDERHNLGFVDDLRS*
Coding >Ophun1|4528
ATGCACAAGATGCGCCCCGAGCGCCGGCTATGGCCCCTACGACTGGCCATCCGCTACCTCACCGTAGCGCTACTC
GTCTCGCTGGCGCTGCTCAACTTCCTGCTCTGGCACCAGACACAGCTCCCCTTCGGCCGTCGACATCCCATCCAG
CGGCTCATGGCCGAGGCCGAAGCCCGGTCTCGGGTCCTCATGGCTCGTCGAAGTCTGGATCTCGCTACGGCCGCG
GCGCGGTATCGCCATCGGAGGAGAAGACATCCGCCTCCGGGATTCGACGATTGGTTCCGCGCTGCTGCTGAGGCT
GACGCCGTCGTGGTCGAGGACTTCTTCGATCGCATATACAAAGACGTCACGCCCTTCTGGGCCCTATCGCCCTCG
TCTATACGCCGCAGGGCCACAGCCTGGCATTGGGTAGTCCGCGTCCGCAACGGCACAGCCTCCCCTCAGGGAAAC
GTCGAGGGCCGCGTCCCCTGGCTTCAGCTCTGGACATCGCTCGTCTCAGAGTTCGCCTCCAAGCTGCCAGACGTC
GACATGCCCATCAACATGCTGGACGAAGCCCGTCTGCTGGTCCCCCACGCAGACATGGCCCGACTGGTAGCCAAA
GCCGAGTCCGAGACCACCATGACCGACCCGGACCTCACCTCGTCACGCTTCTCCGGCCTGGCCGACGTCGACGAC
GATCGTCCACCGCTGTATGAACCCCCCTGGTTCGGCCCGGGCAACTCGTACTGGAATCTGGCGGCCAAGACCTGC
GGCCCGGACACTCCCGCCCACGGCGTCCGTCAGATCCGAGACTTTGCTCCTCCCGCCGAGCTGCCCCCGGACTGG
CGACCGCCGTACGCGCTCGAGGGCTTCGTCCAGAACTGGACGGCCGCCATGGATCCCTGTCTACAGCCTCATCTG
CGTCAGCTACACGGCACCTTCATCGAGCCCCTGAGCCTGTCGTCAACCGACGAACTCATCCCCATCTTCGGCGGC
TCCAAGCTGCCCATGAACAGCGAGATCCTCATCCCCGGCGCCATGTATCTCACCGACGATACCTTCTACTCGGGC
GGTGAAGCCCATGGACCCGCCTGGCCCGATAAAAAGGACGGCCTCATCTGGCGAGGTGATGCTTCGGGAGGTCGC
ACCAAGGAACACAGCTGGCATCACTTCCAGCGCCATCGCCTCGTCGACATGCTCAACGGGACGACCGTCTCCCGC
CTCGAATCCGCCGGCGTCCGCGCCCCGACCTTCTCCCTACCCTCTACCAGCCTGTACCGCCGTCGCCGCCAGCTG
GGCGCCTGGATCGCCCGCTTCGCCGACGCCGCCTTCGTCCACCTCTGTCCGCCCGGCGAGTGCGACTTCGTGAGC
CCCTACTTCCGGCCCTCGGATCAGGTCCCCATGGAAACCCAGTATCAGCACAAGTTCCTGCCCGACGCCGATGGC
AACTCCTTCAGCGCCCGTTTCCGCGGCTTCCTGCGCTCTACCTCGCTGCCCATCAAGGCCACCATCTACGCCGAG
TGGCACGACGACCGCTTGATTCCCTGGCTGCACTTTGTGCCCATGGACAACACCTTTCAGGATCTCTACGCGCTG
CTCGACTTCTTCGCCCCTGGAGGGTCGCTTAACAACAGGGGCGACGCTGCTGCCCGACTCATTGCTGAAAGGGGC
CGTGACTGGGCTGAGACGGTTCTTCGGAGGGAGGATATGCGTCTCTATGTGTGGCGCTTGCTCCTCGAGTGGGCG
CGCGTCTGCGATGACGAGAGGCATAATCTGGGGTTTGTAGATGATCTGAGGAGTTGA
Transcript >Ophun1|4528
ATGCACAAGATGCGCCCCGAGCGCCGGCTATGGCCCCTACGACTGGCCATCCGCTACCTCACCGTAGCGCTACTC
GTCTCGCTGGCGCTGCTCAACTTCCTGCTCTGGCACCAGACACAGCTCCCCTTCGGCCGTCGACATCCCATCCAG
CGGCTCATGGCCGAGGCCGAAGCCCGGTCTCGGGTCCTCATGGCTCGTCGAAGTCTGGATCTCGCTACGGCCGCG
GCGCGGTATCGCCATCGGAGGAGAAGACATCCGCCTCCGGGATTCGACGATTGGTTCCGCGCTGCTGCTGAGGCT
GACGCCGTCGTGGTCGAGGACTTCTTCGATCGCATATACAAAGACGTCACGCCCTTCTGGGCCCTATCGCCCTCG
TCTATACGCCGCAGGGCCACAGCCTGGCATTGGGTAGTCCGCGTCCGCAACGGCACAGCCTCCCCTCAGGGAAAC
GTCGAGGGCCGCGTCCCCTGGCTTCAGCTCTGGACATCGCTCGTCTCAGAGTTCGCCTCCAAGCTGCCAGACGTC
GACATGCCCATCAACATGCTGGACGAAGCCCGTCTGCTGGTCCCCCACGCAGACATGGCCCGACTGGTAGCCAAA
GCCGAGTCCGAGACCACCATGACCGACCCGGACCTCACCTCGTCACGCTTCTCCGGCCTGGCCGACGTCGACGAC
GATCGTCCACCGCTGTATGAACCCCCCTGGTTCGGCCCGGGCAACTCGTACTGGAATCTGGCGGCCAAGACCTGC
GGCCCGGACACTCCCGCCCACGGCGTCCGTCAGATCCGAGACTTTGCTCCTCCCGCCGAGCTGCCCCCGGACTGG
CGACCGCCGTACGCGCTCGAGGGCTTCGTCCAGAACTGGACGGCCGCCATGGATCCCTGTCTACAGCCTCATCTG
CGTCAGCTACACGGCACCTTCATCGAGCCCCTGAGCCTGTCGTCAACCGACGAACTCATCCCCATCTTCGGCGGC
TCCAAGCTGCCCATGAACAGCGAGATCCTCATCCCCGGCGCCATGTATCTCACCGACGATACCTTCTACTCGGGC
GGTGAAGCCCATGGACCCGCCTGGCCCGATAAAAAGGACGGCCTCATCTGGCGAGGTGATGCTTCGGGAGGTCGC
ACCAAGGAACACAGCTGGCATCACTTCCAGCGCCATCGCCTCGTCGACATGCTCAACGGGACGACCGTCTCCCGC
CTCGAATCCGCCGGCGTCCGCGCCCCGACCTTCTCCCTACCCTCTACCAGCCTGTACCGCCGTCGCCGCCAGCTG
GGCGCCTGGATCGCCCGCTTCGCCGACGCCGCCTTCGTCCACCTCTGTCCGCCCGGCGAGTGCGACTTCGTGAGC
CCCTACTTCCGGCCCTCGGATCAGGTCCCCATGGAAACCCAGTATCAGCACAAGTTCCTGCCCGACGCCGATGGC
AACTCCTTCAGCGCCCGTTTCCGCGGCTTCCTGCGCTCTACCTCGCTGCCCATCAAGGCCACCATCTACGCCGAG
TGGCACGACGACCGCTTGATTCCCTGGCTGCACTTTGTGCCCATGGACAACACCTTTCAGGATCTCTACGCGCTG
CTCGACTTCTTCGCCCCTGGAGGGTCGCTTAACAACAGGGGCGACGCTGCTGCCCGACTCATTGCTGAAAGGGGC
CGTGACTGGGCTGAGACGGTTCTTCGGAGGGAGGATATGCGTCTCTATGTGTGGCGCTTGCTCCTCGAGTGGGCG
CGCGTCTGCGATGACGAGAGGCATAATCTGGGGTTTGTAGATGATCTGAGGAGTTGA
Gene >Ophun1|4528
ATGCACAAGATGCGCCCCGAGCGCCGGCTATGGCCCCTACGACTGGCCATCCGCTACCTCACCGTAGCGCTACTC
GTCTCGCTGGCGCTGCTCAACTTCCTGCTCTGGCACCAGACACAGCTCCCCTTCGGCCGTCGACATCCCATCCAG
CGGCTCATGGCCGAGGCCGAAGCCCGGTCTCGGGTCCTCATGGCTCGTCGAAGTCTGGATCTCGCTACGGCCGCG
GCGCGGTATCGCCATCGGAGGAGAAGACATCCGCCTCCGGGATTCGACGATTGGTTCCGCGCTGCTGCTGAGGCT
GACGCCGTCGTGGTCGAGGACTTCTTCGATCGCATATACAAAGACGTCACGCCCTTCTGGGCCCTATCGCCCTCG
TCTATACGCCGCAGGGCCACAGCCTGGCATTGGGTAGTCCGCGTCCGCAACGGCACAGCCTCCCCTCAGGGAAAC
GTCGAGGGCCGCGTCCCCTGGCTTCAGCTCTGGACATCGCTCGTCTCAGAGTTCGCCTCCAAGCTGCCAGACGTC
GACATGCCCATCAACATGCTGGACGAAGCCCGTCTGCTGGTCCCCCACGCAGACATGGCCCGACTGGTAGCCAAA
GCCGAGTCCGAGACCACCATGACCGACCCGGACCTCACCTCGTCACGCTTCTCCGGCCTGGCCGACGTCGACGAC
GATCGTCCACCGCTGTATGAACCCCCCTGGTTCGGCCCGGGCAACTCGTACTGGAATCTGGCGGCCAAGACCTGC
GGCCCGGACACTCCCGCCCACGGCGTCCGTCAGATCCGAGACTTTGCTCCTCCCGCCGAGCTGCCCCCGGACTGG
CGACCGCCGTACGCGCTCGAGGGCTTCGTCCAGAACTGGACGGCCGCCATGGATCCCTGTCTACAGCCTCATCTG
CGTCAGCTACACGGCACCTTCATCGAGCCCCTGAGCCTGTCGTCAACCGACGAACTCATCCCCATCTTCGGCGGC
TCCAAGCTGCCCATGAACAGCGAGATCCTCATCCCCGGCGCCATGTATCTCACCGACGATACCTTCTACTCGGGC
GGTGAAGCCCATGGACCCGCCTGGCCCGATAAAAAGGACGGCCTCATCTGGCGAGGTGATGCTTCGGGAGGTCGC
ACCAAGGAACACAGCTGGCATCACTTCCAGCGCCATCGCCTCGTCGACATGCTCAACGGGACGACCGTCTCCCGC
CTCGAATCCGCCGGCGTCCGCGCCCCGACCTTCTCCCTACCCTCTACCAGCCTGTACCGCCGTCGCCGCCAGCTG
GGCGCCTGGATCGCCCGCTTCGCCGACGCCGCCTTCGTCCACCTCTGTCCGCCCGGCGAGTGCGACTTCGTGAGC
CCCTACTTCCGGCCCTCGGATCAGGTCCCCATGGAAACCCAGTATCAGCACAAGTTCCTGCCCGACGCCGATGGC
AACTCCTTCAGCGCCCGTTTCCGCGGCTTCCTGCGCTCTACCTCGCTGCCCATCAAGGCCACCATCTACGCCGAG
TGGCACGACGACCGCTTGATTCCCTGGCTGCACTTTGTGCCCATGGACAACACCTTTCAGGATCTCTACGCGCTG
CTCGACTTCTTCGCCCCTGGAGGGTCGCTTAACAACAGGGGCGACGCTGCTGCCCGACTCATTGCTGAAAGGGGC
CGTGACTGGGCTGAGACGGTTCTTCGGAGGGAGGATATGCGTCTCTATGTGTGGCGCTTGCTCCTCGAGTGGGCG
CGCGTCTGCGATGACGAGAGGCATAATCTGGGGTTTGTAGATGATCTGAGGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail