Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4524
Gene name
LocationContig_42:5797..7257
Strand+
Gene length (bp)1460
Transcript length (bp)1269
Coding sequence length (bp)1269
Protein length (aa) 423

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01467 CTP_transf_like Cytidylyltransferase-like 9.2E-22 149 272

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74975|PCY1_SCHPO Probable choline-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.02c PE=1 SV=3 133 389 2.0E-88
sp|P13259|PCY1_YEAST Choline-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCT1 PE=1 SV=2 133 332 6.0E-85
sp|Q9QZC4|PCY1B_RAT Choline-phosphate cytidylyltransferase B OS=Rattus norvegicus GN=Pcyt1b PE=1 SV=1 113 336 3.0E-61
sp|Q811Q9|PCY1B_MOUSE Choline-phosphate cytidylyltransferase B OS=Mus musculus GN=Pcyt1b PE=1 SV=2 113 336 3.0E-61
sp|Q9Y5K3|PCY1B_HUMAN Choline-phosphate cytidylyltransferase B OS=Homo sapiens GN=PCYT1B PE=1 SV=1 113 336 2.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74975|PCY1_SCHPO Probable choline-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.02c PE=1 SV=3 133 389 2.0E-88
sp|P13259|PCY1_YEAST Choline-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCT1 PE=1 SV=2 133 332 6.0E-85
sp|Q9QZC4|PCY1B_RAT Choline-phosphate cytidylyltransferase B OS=Rattus norvegicus GN=Pcyt1b PE=1 SV=1 113 336 3.0E-61
sp|Q811Q9|PCY1B_MOUSE Choline-phosphate cytidylyltransferase B OS=Mus musculus GN=Pcyt1b PE=1 SV=2 113 336 3.0E-61
sp|Q9Y5K3|PCY1B_HUMAN Choline-phosphate cytidylyltransferase B OS=Homo sapiens GN=PCYT1B PE=1 SV=1 113 336 2.0E-60
sp|Q9ZV56|CCT1_ARATH Choline-phosphate cytidylyltransferase 1 OS=Arabidopsis thaliana GN=CCT1 PE=1 SV=1 139 347 7.0E-60
sp|P49585|PCY1A_HUMAN Choline-phosphate cytidylyltransferase A OS=Homo sapiens GN=PCYT1A PE=1 SV=2 140 307 1.0E-58
sp|P19836|PCY1A_RAT Choline-phosphate cytidylyltransferase A OS=Rattus norvegicus GN=Pcyt1a PE=1 SV=2 140 307 3.0E-58
sp|P49586|PCY1A_MOUSE Choline-phosphate cytidylyltransferase A OS=Mus musculus GN=Pcyt1a PE=1 SV=1 140 307 5.0E-58
sp|P49584|PCY1A_CRIGR Choline-phosphate cytidylyltransferase A OS=Cricetulus griseus GN=PCYT1A PE=2 SV=1 140 307 4.0E-57
sp|F4JJE0|CCT2_ARATH Choline-phosphate cytidylyltransferase 2 OS=Arabidopsis thaliana GN=CCT2 PE=1 SV=1 143 301 9.0E-57
sp|P49587|PCY1_PLAFK Choline-phosphate cytidylyltransferase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CTP PE=2 SV=1 142 310 2.0E-55
sp|P49583|PCY1_CAEEL Putative choline-phosphate cytidylyltransferase OS=Caenorhabditis elegans GN=F08C6.2 PE=3 SV=2 142 332 2.0E-54
sp|Q55BZ4|PCY2_DICDI Ethanolamine-phosphate cytidylyltransferase OS=Dictyostelium discoideum GN=pctA PE=1 SV=1 143 274 7.0E-27
sp|Q9ZVI9|PECT1_ARATH Ethanolamine-phosphate cytidylyltransferase OS=Arabidopsis thaliana GN=PECT1 PE=1 SV=1 143 274 1.0E-20
sp|Q5EA75|PCY2_BOVIN Ethanolamine-phosphate cytidylyltransferase OS=Bos taurus GN=PCYT2 PE=2 SV=1 131 274 1.0E-19
sp|Q99447|PCY2_HUMAN Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens GN=PCYT2 PE=1 SV=1 131 274 5.0E-19
sp|O88637|PCY2_RAT Ethanolamine-phosphate cytidylyltransferase OS=Rattus norvegicus GN=Pcyt2 PE=1 SV=1 143 274 2.0E-18
sp|Q922E4|PCY2_MOUSE Ethanolamine-phosphate cytidylyltransferase OS=Mus musculus GN=Pcyt2 PE=1 SV=1 143 274 3.0E-18
sp|Q9UTI6|ECT1_SCHPO Probable ethanolamine-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC15E1.05c PE=2 SV=1 146 274 1.0E-17
sp|P33412|ECT1_YEAST Ethanolamine-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECT1 PE=1 SV=1 144 274 4.0E-17
sp|Q8SQW6|ECT1_ENCCU Probable ethanolamine-phosphate cytidylyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=MUQ1 PE=1 SV=1 146 274 5.0E-14
sp|Q55BZ4|PCY2_DICDI Ethanolamine-phosphate cytidylyltransferase OS=Dictyostelium discoideum GN=pctA PE=1 SV=1 147 287 9.0E-14
sp|Q922E4|PCY2_MOUSE Ethanolamine-phosphate cytidylyltransferase OS=Mus musculus GN=Pcyt2 PE=1 SV=1 147 287 1.0E-09
sp|Q9ZVI9|PECT1_ARATH Ethanolamine-phosphate cytidylyltransferase OS=Arabidopsis thaliana GN=PECT1 PE=1 SV=1 147 287 1.0E-09
sp|Q99447|PCY2_HUMAN Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens GN=PCYT2 PE=1 SV=1 147 287 3.0E-09
sp|O88637|PCY2_RAT Ethanolamine-phosphate cytidylyltransferase OS=Rattus norvegicus GN=Pcyt2 PE=1 SV=1 147 287 4.0E-09
sp|Q5EA75|PCY2_BOVIN Ethanolamine-phosphate cytidylyltransferase OS=Bos taurus GN=PCYT2 PE=2 SV=1 147 287 1.0E-08
sp|Q8SQW6|ECT1_ENCCU Probable ethanolamine-phosphate cytidylyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=MUQ1 PE=1 SV=1 139 287 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1593
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5371
Ophiocordyceps australis map64 (Brazil) OphauB2|3952
Ophiocordyceps camponoti-floridani Ophcf2|00937
Ophiocordyceps camponoti-rufipedis Ophun1|4524 (this protein)
Ophiocordyceps kimflemingae Ophio5|4821
Ophiocordyceps subramaniannii Hirsu2|1221

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4524
MSSTSDSHQAGKRKRAAAAKASADVALQTSSRDASGEEGDTTAPESGRHHRINGAGPNPKRQRANPDRAVDVADH
ALDPGEPSDTTEASVDIAERVGRKARKPVVKDCHDDDADKMEAMPPPPIGKLTHPAGGFKTNPPPVGRPVRVYAD
GVFDLHMRQLEQAKKAFPDTTLVVGVTGDKETHMRKGLTVLSAQERAETVRHCKWVDEVIEDCPWIVTPEFLEAN
RLDYVAHDDLPYGADEGDDIYQPIKATGKFLVTQRTEGVSTTGIITRIVRDYEKYLTRQFKRGTPRQELNVSWIK
KNELDLKRHVQDLRDNIITNWTTTGQELSRELKQFWPASRPQSPARFNSSGSDVARSPISSTSGPGNSKEFVTGY
ALGLVGGVRSWMTKNRRTVSDSQHASEDESDEAEDRKKSPTVPSPSA*
Coding >Ophun1|4524
ATGTCGTCCACCTCCGACTCTCACCAGGCTGGCAAACGCAAGAGAGCCGCCGCCGCCAAAGCCTCGGCTGACGTC
GCCCTCCAGACCTCGTCGCGCGATGCCTCGGGCGAAGAAGGCGACACCACCGCCCCCGAGTCCGGACGCCATCAC
CGCATCAACGGCGCCGGTCCGAACCCTAAGCGGCAGCGGGCCAACCCGGACCGCGCTGTCGATGTCGCCGACCAC
GCTCTCGACCCGGGCGAGCCCAGCGACACCACCGAGGCCAGCGTTGACATCGCCGAGCGCGTCGGTCGCAAGGCT
CGCAAGCCAGTCGTCAAGGACTGCCACGACGATGACGCCGACAAGATGGAAGCCATGCCGCCTCCGCCCATCGGC
AAGCTGACCCATCCAGCCGGCGGCTTCAAGACGAACCCGCCACCCGTCGGTCGCCCCGTCCGCGTTTACGCTGAC
GGCGTCTTTGACCTGCACATGCGCCAGCTCGAGCAGGCTAAAAAGGCTTTCCCTGACACCACGCTCGTCGTCGGT
GTCACGGGCGATAAAGAGACGCATATGCGCAAGGGCCTGACTGTTCTTTCTGCCCAGGAACGCGCCGAGACGGTT
CGACACTGCAAGTGGGTTGACGAGGTCATCGAGGACTGCCCATGGATCGTTACGCCCGAGTTCCTCGAGGCCAAT
CGGCTCGACTATGTCGCACACGATGATCTGCCCTACGGCGCCGACGAAGGCGACGACATCTATCAGCCCATCAAG
GCCACCGGCAAGTTCCTCGTCACCCAGCGAACCGAGGGTGTCAGCACCACTGGCATCATCACCAGAATCGTCCGT
GACTACGAAAAGTATCTCACCCGGCAGTTCAAGCGCGGCACGCCGCGACAGGAACTGAACGTCAGCTGGATCAAG
AAGAACGAGCTGGACCTGAAGCGCCATGTGCAGGACCTGCGAGATAACATCATCACCAACTGGACGACGACTGGC
CAGGAGCTGAGCCGCGAGCTGAAGCAATTCTGGCCCGCCAGTCGACCGCAGAGCCCGGCTCGTTTCAACTCGTCC
GGAAGCGACGTGGCCCGGTCACCCATCAGCTCGACCTCGGGCCCGGGCAACTCGAAGGAGTTTGTGACGGGATAC
GCCCTCGGTCTTGTAGGCGGCGTGCGGTCCTGGATGACCAAGAACAGAAGGACCGTGTCCGACAGCCAACACGCA
AGCGAAGACGAGTCGGATGAAGCCGAGGATCGCAAGAAATCGCCAACTGTGCCTTCGCCCTCGGCTTGA
Transcript >Ophun1|4524
ATGTCGTCCACCTCCGACTCTCACCAGGCTGGCAAACGCAAGAGAGCCGCCGCCGCCAAAGCCTCGGCTGACGTC
GCCCTCCAGACCTCGTCGCGCGATGCCTCGGGCGAAGAAGGCGACACCACCGCCCCCGAGTCCGGACGCCATCAC
CGCATCAACGGCGCCGGTCCGAACCCTAAGCGGCAGCGGGCCAACCCGGACCGCGCTGTCGATGTCGCCGACCAC
GCTCTCGACCCGGGCGAGCCCAGCGACACCACCGAGGCCAGCGTTGACATCGCCGAGCGCGTCGGTCGCAAGGCT
CGCAAGCCAGTCGTCAAGGACTGCCACGACGATGACGCCGACAAGATGGAAGCCATGCCGCCTCCGCCCATCGGC
AAGCTGACCCATCCAGCCGGCGGCTTCAAGACGAACCCGCCACCCGTCGGTCGCCCCGTCCGCGTTTACGCTGAC
GGCGTCTTTGACCTGCACATGCGCCAGCTCGAGCAGGCTAAAAAGGCTTTCCCTGACACCACGCTCGTCGTCGGT
GTCACGGGCGATAAAGAGACGCATATGCGCAAGGGCCTGACTGTTCTTTCTGCCCAGGAACGCGCCGAGACGGTT
CGACACTGCAAGTGGGTTGACGAGGTCATCGAGGACTGCCCATGGATCGTTACGCCCGAGTTCCTCGAGGCCAAT
CGGCTCGACTATGTCGCACACGATGATCTGCCCTACGGCGCCGACGAAGGCGACGACATCTATCAGCCCATCAAG
GCCACCGGCAAGTTCCTCGTCACCCAGCGAACCGAGGGTGTCAGCACCACTGGCATCATCACCAGAATCGTCCGT
GACTACGAAAAGTATCTCACCCGGCAGTTCAAGCGCGGCACGCCGCGACAGGAACTGAACGTCAGCTGGATCAAG
AAGAACGAGCTGGACCTGAAGCGCCATGTGCAGGACCTGCGAGATAACATCATCACCAACTGGACGACGACTGGC
CAGGAGCTGAGCCGCGAGCTGAAGCAATTCTGGCCCGCCAGTCGACCGCAGAGCCCGGCTCGTTTCAACTCGTCC
GGAAGCGACGTGGCCCGGTCACCCATCAGCTCGACCTCGGGCCCGGGCAACTCGAAGGAGTTTGTGACGGGATAC
GCCCTCGGTCTTGTAGGCGGCGTGCGGTCCTGGATGACCAAGAACAGAAGGACCGTGTCCGACAGCCAACACGCA
AGCGAAGACGAGTCGGATGAAGCCGAGGATCGCAAGAAATCGCCAACTGTGCCTTCGCCCTCGGCTTGA
Gene >Ophun1|4524
ATGTCGTCCACCTCCGACTCTCACCAGGCTGGCAAACGCAAGAGAGCCGCCGCCGCCAAAGCCTCGGCTGACGTC
GCCCTCCAGACCTCGTCGCGCGATGCCTCGGGCGAAGAAGGCGACACCACCGCCCCCGAGTCCGGACGCCATCAC
CGCATCAACGGCGCCGGTCCGAACCCTAAGCGGCAGCGGGCCAACCCGGACCGCGCTGTCGATGTCGCCGACCAC
GCTCTCGACCCGGGCGAGCCCAGCGACACCACCGAGGCCAGCGTTGACATCGCCGAGCGCGTCGGTCGCAAGGCT
CGCAAGCCAGTCGTCAAGGACTGCCACGACGATGACGCCGACAAGATGGAAGCCATGCCGCCTCCGCCCATCGGC
AAGCTGACCCATCCAGCCGGCGGCTTCAAGACGAACCCGCCACCCGTCGGTCGCCCCGTCCGCGTTTACGCTGAC
GGCGTCTTTGACCTGTTTCATCTCGGGCACGTCCAACCTCGTTCCGTCTCGCGTTACCGCCTCTGACCGTCAACC
GTCCTTCAGGCACATGCGCCAGCTCGAGCAGGCTAAAAAGGCTTTCCCTGACACCACGCTCGTCGTCGGTGTCAC
GGGCGATAAAGAGACGCATATGCGCAAGGGCCTGACTGTTCTTTCTGCCCAGGAACGCGCCGAGACGGTTCGACA
CTGCAAGTGGGTTGACGAGGTCATCGAGGACTGCCCATGGATCGTTACGCCCGAGTTCCTCGAGGCCAATCGGCT
CGACTATGTCGCACACGATGATCTGCCCTACGGCGCCGACGAAGGCGACGACATCTATCAGCCCATCAAGGCCAC
CGGCAAGTTCCTCGTCACCCAGCGAACCGAGGGTGTCAGCACCACTGGCATCATCACCAGGTCCGTAGCGCCCTT
GTTTCGCCTGCTTTCCCCCCTCCTTAGCCTGACATGTGCCGCACGCCAGAATCGTCCGTGACTACGAAAAGTATC
TCACCCGGCAGTTCAAGCGCGGCACGCCGCGACAGGAACTGAACGTCAGCTGGATCAAGAAGAACGAGCTGGACC
TGAAGCGCCATGTGCAGGACCTGCGAGATAACATCATCACCAACTGGACGACGACTGGCCAGGAGCTGAGCCGCG
AGCTGAAGCAATTCTGGCCCGCCAGTCGACCGCAGAGCCCGGCTCGTTTCAACTCGTCCGGAAGCGACGTGGCCC
GGTCACCCATCAGCTCGACCTCGGGCCCGGGCAACTCGAAGGAGTTTGTGACGGGATACGCCCTCGGTCTTGTAG
GCGGCGTGCGGTCCTGGGTGAGAAACGAGACTCCTCTGTGAGCGGGTAGAGTTCAAGCTGACAGAAGCCCGCAGA
TGACCAAGAACAGAAGGACCGTGTCCGACAGCCAACACGCAAGCGAAGACGAGTCGGATGAAGCCGAGGATCGCA
AGAAATCGCCAACTGTGCCTTCGCCCTCGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail