Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4517
Gene name
LocationContig_419:8455..9089
Strand+
Gene length (bp)634
Transcript length (bp)453
Coding sequence length (bp)453
Protein length (aa) 151

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain 7.9E-30 63 134
PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain 1.1E-11 64 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28000|RPAC2_YEAST DNA-directed RNA polymerases I and III subunit RPAC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC19 PE=1 SV=1 22 139 7.0E-36
sp|Q09177|RPAC2_SCHPO DNA-directed RNA polymerases I and III subunit RPAC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc19 PE=2 SV=1 50 139 3.0E-29
sp|Q5XK67|RPAC2_XENLA DNA-directed RNA polymerases I and III subunit RPAC2 OS=Xenopus laevis GN=polr1d PE=3 SV=1 57 136 4.0E-24
sp|Q6DRI4|RPAC2_DANRE DNA-directed RNA polymerases I and III subunit RPAC2 OS=Danio rerio GN=polr1d PE=3 SV=1 45 136 4.0E-23
sp|Q1RMG8|RPAC2_BOVIN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Bos taurus GN=POLR1D PE=2 SV=1 57 144 2.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28000|RPAC2_YEAST DNA-directed RNA polymerases I and III subunit RPAC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC19 PE=1 SV=1 22 139 7.0E-36
sp|Q09177|RPAC2_SCHPO DNA-directed RNA polymerases I and III subunit RPAC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc19 PE=2 SV=1 50 139 3.0E-29
sp|Q5XK67|RPAC2_XENLA DNA-directed RNA polymerases I and III subunit RPAC2 OS=Xenopus laevis GN=polr1d PE=3 SV=1 57 136 4.0E-24
sp|Q6DRI4|RPAC2_DANRE DNA-directed RNA polymerases I and III subunit RPAC2 OS=Danio rerio GN=polr1d PE=3 SV=1 45 136 4.0E-23
sp|Q1RMG8|RPAC2_BOVIN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Bos taurus GN=POLR1D PE=2 SV=1 57 144 2.0E-22
sp|Q9VIZ0|RPAC2_DROME Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Drosophila melanogaster GN=l(2)37Cg PE=3 SV=1 60 147 2.0E-21
sp|Q9Y2S0|RPAC2_HUMAN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens GN=POLR1D PE=1 SV=1 57 144 2.0E-21
sp|P97304|RPAC2_MOUSE DNA-directed RNA polymerases I and III subunit RPAC2 OS=Mus musculus GN=Polr1d PE=1 SV=1 57 136 1.0E-20
sp|Q54ES6|RPC19_DICDI DNA-directed RNA polymerases I and III subunit rpc19 OS=Dictyostelium discoideum GN=rpc19 PE=3 SV=1 63 128 1.0E-19
sp|Q9XVH6|RPB11_CAEEL Probable DNA-directed RNA polymerase II subunit RPB11 OS=Caenorhabditis elegans GN=rpb-11 PE=3 SV=1 61 125 1.0E-10
sp|Q9VJE4|RPB11_DROME DNA-directed RNA polymerase II subunit RPB11 OS=Drosophila melanogaster GN=Rpb11 PE=3 SV=1 48 109 3.0E-10
sp|P34476|RPAC2_CAEEL Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Caenorhabditis elegans GN=rpac-19 PE=3 SV=1 61 136 4.0E-10
sp|Q61IX2|RPAC2_CAEBR Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Caenorhabditis briggsae GN=rpac-19 PE=3 SV=1 61 142 6.0E-10
sp|Q60SM4|RPB11_CAEBR Probable DNA-directed RNA polymerase II subunit RPB11 OS=Caenorhabditis briggsae GN=rpb-11 PE=3 SV=1 61 125 1.0E-09
sp|Q7PVQ9|RPB11_ANOGA DNA-directed RNA polymerase II subunit RPB11 OS=Anopheles gambiae GN=Rpb11 PE=3 SV=2 48 125 3.0E-09
sp|Q86JJ5|RPB11_DICDI DNA-directed RNA polymerase II subunit rpb11 OS=Dictyostelium discoideum GN=polr2j PE=3 SV=1 61 113 6.0E-08
sp|O08740|RPB11_MOUSE DNA-directed RNA polymerase II subunit RPB11 OS=Mus musculus GN=Polr2j PE=1 SV=1 61 109 1.0E-07
sp|P52435|RPB11_HUMAN DNA-directed RNA polymerase II subunit RPB11-a OS=Homo sapiens GN=POLR2J PE=1 SV=1 61 109 1.0E-07
sp|Q32P79|RPB11_BOVIN DNA-directed RNA polymerase II subunit RPB11 OS=Bos taurus GN=POLR2J PE=3 SV=1 61 109 1.0E-07
sp|Q9GZM3|RPB1B_HUMAN DNA-directed RNA polymerase II subunit RPB11-b1 OS=Homo sapiens GN=POLR2J2 PE=1 SV=2 62 109 2.0E-07
sp|Q9H1A7|RPB1C_HUMAN DNA-directed RNA polymerase II subunit RPB11-b2 OS=Homo sapiens GN=POLR2J3 PE=3 SV=1 61 109 2.0E-07
sp|Q38859|NRPBB_ARATH DNA-directed RNA polymerases II, IV and V subunit 11 OS=Arabidopsis thaliana GN=NRPB11 PE=1 SV=1 61 136 2.0E-07
sp|Q57832|RPOL_METJA DNA-directed RNA polymerase subunit L OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoL PE=1 SV=1 60 140 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0046983 protein dimerization activity Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016740 transferase activity No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:0032774 RNA biosynthetic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034062 5'-3' RNA polymerase activity No
GO:0009058 biosynthetic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0097747 RNA polymerase activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0005515 protein binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0090304 nucleic acid metabolic process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4240
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5138
Ophiocordyceps australis map64 (Brazil) OphauB2|6176
Ophiocordyceps camponoti-floridani Ophcf2|04998
Ophiocordyceps camponoti-rufipedis Ophun1|4517 (this protein)
Ophiocordyceps kimflemingae Ophio5|5793
Ophiocordyceps subramaniannii Hirsu2|8653

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4517
MPGRTSKVEETPSQDVAMQNAPPSAQPEDTQDVEMGEDDGEPVDGQDDKEEAQRLPGSTDSAASFEFLEEGHTLG
NALRYIIMKNPNVEFCAYAIPHPSEPKMNIRIQTFEGTAVDALRKGLVDLQDVCDVVAKEYWDKRCAFNVEKGLT
*
Coding >Ophun1|4517
ATGCCGGGTCGGACGAGCAAAGTCGAGGAAACTCCCTCGCAAGACGTCGCGATGCAGAATGCGCCCCCGTCGGCA
CAGCCAGAAGACACTCAGGATGTCGAGATGGGCGAGGATGACGGCGAGCCGGTAGACGGCCAAGACGACAAGGAG
GAGGCCCAGCGGCTGCCCGGTTCGACCGATTCTGCTGCATCCTTTGAGTTCTTGGAGGAGGGACACACTCTGGGC
AACGCCCTGAGATATATCATCATGAAGAACCCAAACGTCGAGTTTTGCGCCTACGCCATCCCTCACCCTTCCGAG
CCGAAGATGAACATCAGGATACAAACATTTGAAGGCACTGCGGTGGATGCCTTGAGAAAGGGGCTGGTTGACCTG
CAAGACGTGTGCGATGTCGTGGCCAAGGAATACTGGGATAAGAGATGCGCCTTCAACGTCGAGAAGGGTCTGACG
TGA
Transcript >Ophun1|4517
ATGCCGGGTCGGACGAGCAAAGTCGAGGAAACTCCCTCGCAAGACGTCGCGATGCAGAATGCGCCCCCGTCGGCA
CAGCCAGAAGACACTCAGGATGTCGAGATGGGCGAGGATGACGGCGAGCCGGTAGACGGCCAAGACGACAAGGAG
GAGGCCCAGCGGCTGCCCGGTTCGACCGATTCTGCTGCATCCTTTGAGTTCTTGGAGGAGGGACACACTCTGGGC
AACGCCCTGAGATATATCATCATGAAGAACCCAAACGTCGAGTTTTGCGCCTACGCCATCCCTCACCCTTCCGAG
CCGAAGATGAACATCAGGATACAAACATTTGAAGGCACTGCGGTGGATGCCTTGAGAAAGGGGCTGGTTGACCTG
CAAGACGTGTGCGATGTCGTGGCCAAGGAATACTGGGATAAGAGATGCGCCTTCAACGTCGAGAAGGGTCTGACG
TGA
Gene >Ophun1|4517
ATGCCGGGTCGGACGAGCAAAGTCGAGGAAACTCCCTCGCAAGACGTCGCGATGCAGAATGCGCCCCCGTCGGCA
CAGCCAGAAGACACTCAGGATGTCGAGATGGGCGAGGATGACGGCGAGCCGGTAGACGGCCAAGACGACAAGGAG
GAGGCCCAGCGGGTGAGAATCGTACGGCTCTTCCCTACCTGGACAGATAGACCGAGCCCGGCTGACCATGACATG
TCCAGCTGCCCGGTTCGACCGATTCTGCTGCATCCTTTGAGTTCTTGGAGGAGGGACACACTCTGGGCAACGCCC
TGAGATATATCATCATGAAGAAGTGGGCAGACTCATCTGGCTAGCAATTGGTTCGCGTGAAGAAGCTGACTCGTC
CAAGCCCAAACGTCGAGTTTTGCGCCTACGCCATCCCTCACCCTTCCGAGCCGAAGATGAACATCAGGATACAAA
CATTTGGTAAGTCTACGCGAGGATTGCGTCCGCGACACGGAGTCTCTGACCGAAGCAAACAGAAGGCACTGCGGT
GGATGCCTTGAGAAAGGGGCTGGTTGACCTGCAAGACGTGTGCGATGTCGTGGCCAAGGAATACTGGGATAAGAG
ATGCGCCTTCAACGTCGAGAAGGGTCTGACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail