Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4507
Gene name
LocationContig_418:313..1990
Strand+
Gene length (bp)1677
Transcript length (bp)1566
Coding sequence length (bp)1566
Protein length (aa) 522

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I298|MRS2_GIBZE Mitochondrial inner membrane magnesium transporter MRS2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MRS2 PE=3 SV=1 99 519 0.0E+00
sp|Q7SFQ9|MRS2_NEUCR Mitochondrial inner membrane magnesium transporter mrs2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrs2 PE=3 SV=1 80 520 4.0E-171
sp|Q4WCV3|MRS2_ASPFU Mitochondrial inner membrane magnesium transporter mrs2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrs2 PE=3 SV=1 96 470 2.0E-140
sp|Q6C8H7|LPE10_YARLI Mitochondrial inner membrane magnesium transporter LPE10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LPE10 PE=3 SV=1 124 470 2.0E-107
sp|P87149|MRS2_SCHPO Mitochondrial inner membrane magnesium transporter mrs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrs2 PE=3 SV=1 124 484 6.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I298|MRS2_GIBZE Mitochondrial inner membrane magnesium transporter MRS2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MRS2 PE=3 SV=1 99 519 0.0E+00
sp|Q7SFQ9|MRS2_NEUCR Mitochondrial inner membrane magnesium transporter mrs2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrs2 PE=3 SV=1 80 520 4.0E-171
sp|Q4WCV3|MRS2_ASPFU Mitochondrial inner membrane magnesium transporter mrs2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrs2 PE=3 SV=1 96 470 2.0E-140
sp|Q6C8H7|LPE10_YARLI Mitochondrial inner membrane magnesium transporter LPE10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LPE10 PE=3 SV=1 124 470 2.0E-107
sp|P87149|MRS2_SCHPO Mitochondrial inner membrane magnesium transporter mrs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrs2 PE=3 SV=1 124 484 6.0E-86
sp|Q6C2P2|MRS2_YARLI Mitochondrial inner membrane magnesium transporter MRS2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRS2 PE=3 SV=1 117 479 1.0E-78
sp|Q5A970|MRS2_CANAL Mitochondrial inner membrane magnesium transporter MRS2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRS2 PE=3 SV=1 127 479 1.0E-76
sp|Q6BX67|MRS2_DEBHA Mitochondrial inner membrane magnesium transporter MRS2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MRS2 PE=3 SV=2 100 478 7.0E-76
sp|Q6CIB3|LPE10_KLULA Mitochondrial inner membrane magnesium transporter LPE10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LPE10 PE=3 SV=1 97 478 7.0E-76
sp|Q6FV22|MRS2_CANGA Mitochondrial inner membrane magnesium transporter MRS2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRS2 PE=3 SV=1 122 477 1.0E-73
sp|Q759B8|MRS2_ASHGO Mitochondrial inner membrane magnesium transporter MRS2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRS2 PE=3 SV=1 124 478 1.0E-72
sp|Q6FJD1|LPE10_CANGA Mitochondrial inner membrane magnesium transporter LPE10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LPE10 PE=3 SV=1 125 470 1.0E-72
sp|Q6CLJ5|MRS2_KLULA Mitochondrial inner membrane magnesium transporter MRS2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRS2 PE=3 SV=1 122 471 4.0E-72
sp|Q02783|LPE10_YEAST Mitochondrial inner membrane magnesium transporter MFM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MFM1 PE=1 SV=1 125 471 8.0E-72
sp|Q01926|MRS2_YEAST Magnesium transporter MRS2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS2 PE=1 SV=2 124 480 6.0E-71
sp|Q75A69|LPE10_ASHGO Mitochondrial inner membrane magnesium transporter LPE10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LPE10 PE=3 SV=2 85 473 7.0E-68
sp|Q59S85|LPE10_CANAL Mitochondrial inner membrane magnesium transporter LPE10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LPE10 PE=3 SV=1 167 470 1.0E-61
sp|Q4R4M1|MRS2_MACFA Magnesium transporter MRS2 homolog, mitochondrial OS=Macaca fascicularis GN=MRS2 PE=2 SV=1 119 445 4.0E-22
sp|Q9HD23|MRS2_HUMAN Magnesium transporter MRS2 homolog, mitochondrial OS=Homo sapiens GN=MRS2 PE=1 SV=1 119 445 1.0E-21
sp|Q058N4|MRS2B_ARATH Magnesium transporter MRS2-11, chloroplastic OS=Arabidopsis thaliana GN=MRS2-11 PE=2 SV=1 122 462 3.0E-21
sp|Q9ET09|MRS2_RAT Magnesium transporter MRS2 homolog, mitochondrial OS=Rattus norvegicus GN=Mrs2 PE=2 SV=1 119 445 8.0E-21
sp|Q5NCE8|MRS2_MOUSE Magnesium transporter MRS2 homolog, mitochondrial OS=Mus musculus GN=Mrs2 PE=2 SV=2 119 445 2.0E-20
sp|Q5R447|MRS2_PONAB Magnesium transporter MRS2 homolog, mitochondrial OS=Pongo abelii GN=MRS2 PE=2 SV=1 119 445 3.0E-20
sp|A3BV82|MRS2G_ORYSJ Putative magnesium transporter MRS2-G OS=Oryza sativa subsp. japonica GN=MRS2-G PE=1 SV=2 142 458 9.0E-18
sp|A2Z9W7|MRS2G_ORYSI Putative magnesium transporter MRS2-G OS=Oryza sativa subsp. indica GN=MRS2-G PE=3 SV=2 142 458 9.0E-18
sp|Q304A0|MRS27_ARATH Magnesium transporter MRS2-7 OS=Arabidopsis thaliana GN=MRS2-7 PE=2 SV=1 101 431 3.0E-17
sp|Q9AUK4|MRS2A_ORYSJ Magnesium transporter MRS2-A, chloroplastic OS=Oryza sativa subsp. japonica GN=MRS2-A PE=2 SV=1 122 462 8.0E-16
sp|B8APK3|MRS2A_ORYSI Magnesium transporter MRS2-A, chloroplastic OS=Oryza sativa subsp. indica GN=MRS2-A PE=3 SV=1 122 462 8.0E-16
sp|Q67UQ7|MRS2B_ORYSJ Magnesium transporter MRS2-B OS=Oryza sativa subsp. japonica GN=MRS2-B PE=2 SV=1 132 457 3.0E-15
sp|A2YFN7|MRS2B_ORYSI Magnesium transporter MRS2-B OS=Oryza sativa subsp. indica GN=MRS2-B PE=3 SV=1 132 457 3.0E-15
sp|Q93ZD7|MRS24_ARATH Magnesium transporter MRS2-4 OS=Arabidopsis thaliana GN=MRS2-4 PE=2 SV=1 142 429 6.0E-15
sp|Q9SAH0|MRS2A_ARATH Magnesium transporter MRS2-10 OS=Arabidopsis thaliana GN=MRS2-10 PE=2 SV=1 142 457 6.0E-15
sp|Q9S9N4|MRS21_ARATH Magnesium transporter MRS2-1 OS=Arabidopsis thaliana GN=MRS2-1 PE=2 SV=1 130 430 8.0E-14
sp|Q8IIG4|MRS2_PLAF7 Putative mitochondrial inner membrane magnesium transporter PF11_0210 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0210 PE=3 SV=2 230 457 1.0E-13
sp|Q1PE39|MRS26_ARATH Magnesium transporter MRS2-6, mitochondrial OS=Arabidopsis thaliana GN=MRS2-6 PE=2 SV=1 145 464 3.0E-13
sp|Q8L4S2|MRS2F_ORYSJ Magnesium transporter MRS2-F OS=Oryza sativa subsp. japonica GN=MRS2-F PE=1 SV=1 142 429 3.0E-12
sp|A2WY50|MRS2F_ORYSI Magnesium transporter MRS2-F OS=Oryza sativa subsp. indica GN=MRS2-F PE=3 SV=1 142 429 3.0E-12
sp|P0CZ21|MRS28_ARATH Magnesium transporter MRS2-8 OS=Arabidopsis thaliana GN=MRS2-8 PE=2 SV=1 130 429 1.0E-11
sp|A2XV81|MRS2C_ORYSI Magnesium transporter MRS2-C OS=Oryza sativa subsp. indica GN=H0311C03.3 PE=3 SV=2 142 464 1.0E-10
sp|Q0JBZ6|MRS2C_ORYSJ Magnesium transporter MRS2-C OS=Oryza sativa subsp. japonica GN=MRS2-C PE=3 SV=3 142 464 1.0E-10
sp|B8AJT9|MRS2I_ORYSI Magnesium transporter MRS2-I OS=Oryza sativa subsp. indica GN=MRS2-I PE=3 SV=1 145 429 2.0E-10
sp|Q10D38|MRS2I_ORYSJ Magnesium transporter MRS2-I OS=Oryza sativa subsp. japonica GN=MRS2-I PE=2 SV=1 145 429 2.0E-10
sp|Q9FLG2|MRS22_ARATH Magnesium transporter MRS2-2 OS=Arabidopsis thaliana GN=MRS2-2 PE=2 SV=1 142 429 8.0E-10
sp|Q10S25|MRS2H_ORYSJ Putative magnesium transporter MRS2-H OS=Oryza sativa subsp. japonica GN=MRS2-H PE=2 SV=1 137 460 8.0E-10
sp|Q01JR9|MRS2D_ORYSI Putative magnesium transporter MRS2-D OS=Oryza sativa subsp. indica GN=MRS2-D PE=3 SV=1 227 450 1.0E-09
sp|A2XCA0|MRS2H_ORYSI Putative magnesium transporter MRS2-H OS=Oryza sativa subsp. indica GN=MRS2-H PE=3 SV=1 137 460 1.0E-09
sp|Q7XQQ1|MRS2D_ORYSJ Putative magnesium transporter MRS2-D OS=Oryza sativa subsp. japonica GN=MRS2-D PE=3 SV=1 227 450 2.0E-09
sp|Q9ZPR4|MRS25_ARATH Magnesium transporter MRS2-5 OS=Arabidopsis thaliana GN=MRS2-5 PE=2 SV=1 128 318 9.0E-09
sp|Q9LJN2|MRS23_ARATH Magnesium transporter MRS2-3 OS=Arabidopsis thaliana GN=MRS2-3 PE=2 SV=1 145 333 2.0E-08
sp|P0CZ22|MRS2I_ARATH Putative inactive magnesium transporter MRS2-8 OS=Arabidopsis thaliana GN=MRS2-8 PE=5 SV=1 130 321 2.0E-07
sp|Q8S1N1|MRS2E_ORYSJ Magnesium transporter MRS2-E OS=Oryza sativa subsp. japonica GN=MRS2-E PE=2 SV=1 142 318 4.0E-06
sp|A2WXD3|MRS2E_ORYSI Magnesium transporter MRS2-E OS=Oryza sativa subsp. indica GN=MRS2-E PE=3 SV=1 142 318 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 406 428 22
2 438 460 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4507
MQPAPRPAVPRLFRFLQPRGQVWRGPGSSLRWDPRRFDGLLLCCCRYHDCGSGSVHDKTAAATTTTGSWKDRLLS
YGNGGGGGGGGGGGARSCAGSLRDEFAPGGSSMFNSRRVMTAKAALEPMLRCTEVDENGKAILTDGEFKKTELIA
KFGLLPRDLRKIDSSNLPHILVRPSAILLNLLHLKVLIKHDRVFLFDVHGSKESWPQSAFMHDLKNKLEQQPKPS
QGPNGLPYEFRALEATLMSVTSEMEAEFESVREPVMHILSELEDDIDRDKLRMLLILSKRISTFEQKSKLVRDAI
EELLEADDDLSAMYLTEKAGGTRQRRGNDDHTEVEMLLESYHKLTDEIVQEAGNLVSGIRNTEEMWETAPPVVFD
FEKQVRLTKDVPCSVRAILDANRNALMLLDLKFSVGTLGLAMGTFVAGLYGMNLENFIEESQVGFALVAGASAAM
SLLVCWYGLAKLRRTQRIKMMMGGHESSRVPRSLTFRDDGALGVLDSRNREFLRRAQMQRASMMVKKPWWR*
Coding >Ophun1|4507
ATGCAACCGGCGCCCCGACCAGCAGTCCCTCGCCTCTTCCGATTCCTCCAGCCGCGAGGGCAGGTCTGGCGCGGG
CCTGGCAGCTCTCTGCGCTGGGATCCGCGCCGGTTCGACGGGTTGCTTCTGTGCTGCTGCCGCTACCATGACTGC
GGCTCCGGTTCGGTGCATGACAAGACGGCGGCGGCGACGACGACGACGGGGAGCTGGAAGGATAGGCTGCTGAGC
TACGGTAATGGCGGTGGCGGTGGTGGTGGTGGTGGAGGTGGTGCGAGGTCCTGCGCTGGGTCGCTGCGGGATGAG
TTTGCGCCGGGGGGGTCGTCCATGTTTAACAGTCGGAGGGTGATGACGGCCAAGGCGGCGTTGGAGCCCATGCTG
CGATGTACCGAGGTGGACGAGAATGGCAAGGCGATCCTTACGGATGGGGAGTTTAAGAAGACGGAGTTGATTGCA
AAGTTTGGTCTTTTGCCTCGCGATCTGCGCAAGATTGACTCGTCCAATCTGCCTCACATCCTGGTCCGGCCATCG
GCCATCCTCCTCAACCTGCTGCACCTCAAGGTGCTGATCAAGCACGACCGCGTCTTCCTCTTCGACGTACACGGA
TCCAAAGAGTCGTGGCCGCAGTCGGCCTTTATGCACGACCTCAAGAACAAGCTGGAGCAGCAGCCGAAGCCGTCG
CAGGGTCCCAACGGACTACCGTACGAGTTCCGCGCCCTCGAGGCGACGCTCATGTCGGTCACGTCGGAGATGGAG
GCCGAGTTCGAGTCGGTGCGCGAGCCGGTTATGCATATCCTCAGCGAGCTCGAGGACGACATCGATCGCGATAAG
CTGCGGATGCTGCTGATCCTGTCCAAGCGCATCAGCACGTTTGAGCAGAAGTCGAAGCTGGTGCGCGATGCTATC
GAGGAGTTGCTCGAGGCGGATGACGACTTGTCGGCCATGTACCTCACCGAGAAGGCGGGAGGGACGAGGCAGCGA
CGCGGCAACGATGATCATACCGAGGTGGAGATGCTGCTGGAATCCTATCACAAGCTCACCGACGAGATTGTGCAG
GAGGCGGGCAACCTGGTATCCGGGATACGGAACACGGAGGAGATGTGGGAGACTGCCCCCCCCGTTGTCTTTGAT
TTCGAAAAGCAAGTTCGGCTAACAAAAGACGTGCCATGCAGCGTCCGCGCCATCCTCGACGCCAACCGCAACGCC
CTCATGCTCCTGGACCTCAAGTTCAGCGTCGGCACCCTCGGCCTCGCAATGGGAACCTTTGTCGCGGGCCTCTAC
GGCATGAACCTGGAGAACTTCATCGAGGAGTCGCAGGTGGGCTTCGCTCTGGTGGCGGGCGCCTCGGCGGCCATG
TCGCTGCTGGTCTGCTGGTACGGGCTGGCCAAGCTGCGGCGGACGCAGCGCATCAAGATGATGATGGGCGGACAC
GAATCTTCGCGGGTCCCTCGCAGCTTGACGTTTCGGGATGACGGGGCGTTGGGCGTGTTGGATTCGAGGAATAGG
GAGTTTTTGAGGAGGGCTCAGATGCAGAGGGCCAGCATGATGGTGAAGAAGCCTTGGTGGAGGTGA
Transcript >Ophun1|4507
ATGCAACCGGCGCCCCGACCAGCAGTCCCTCGCCTCTTCCGATTCCTCCAGCCGCGAGGGCAGGTCTGGCGCGGG
CCTGGCAGCTCTCTGCGCTGGGATCCGCGCCGGTTCGACGGGTTGCTTCTGTGCTGCTGCCGCTACCATGACTGC
GGCTCCGGTTCGGTGCATGACAAGACGGCGGCGGCGACGACGACGACGGGGAGCTGGAAGGATAGGCTGCTGAGC
TACGGTAATGGCGGTGGCGGTGGTGGTGGTGGTGGAGGTGGTGCGAGGTCCTGCGCTGGGTCGCTGCGGGATGAG
TTTGCGCCGGGGGGGTCGTCCATGTTTAACAGTCGGAGGGTGATGACGGCCAAGGCGGCGTTGGAGCCCATGCTG
CGATGTACCGAGGTGGACGAGAATGGCAAGGCGATCCTTACGGATGGGGAGTTTAAGAAGACGGAGTTGATTGCA
AAGTTTGGTCTTTTGCCTCGCGATCTGCGCAAGATTGACTCGTCCAATCTGCCTCACATCCTGGTCCGGCCATCG
GCCATCCTCCTCAACCTGCTGCACCTCAAGGTGCTGATCAAGCACGACCGCGTCTTCCTCTTCGACGTACACGGA
TCCAAAGAGTCGTGGCCGCAGTCGGCCTTTATGCACGACCTCAAGAACAAGCTGGAGCAGCAGCCGAAGCCGTCG
CAGGGTCCCAACGGACTACCGTACGAGTTCCGCGCCCTCGAGGCGACGCTCATGTCGGTCACGTCGGAGATGGAG
GCCGAGTTCGAGTCGGTGCGCGAGCCGGTTATGCATATCCTCAGCGAGCTCGAGGACGACATCGATCGCGATAAG
CTGCGGATGCTGCTGATCCTGTCCAAGCGCATCAGCACGTTTGAGCAGAAGTCGAAGCTGGTGCGCGATGCTATC
GAGGAGTTGCTCGAGGCGGATGACGACTTGTCGGCCATGTACCTCACCGAGAAGGCGGGAGGGACGAGGCAGCGA
CGCGGCAACGATGATCATACCGAGGTGGAGATGCTGCTGGAATCCTATCACAAGCTCACCGACGAGATTGTGCAG
GAGGCGGGCAACCTGGTATCCGGGATACGGAACACGGAGGAGATGTGGGAGACTGCCCCCCCCGTTGTCTTTGAT
TTCGAAAAGCAAGTTCGGCTAACAAAAGACGTGCCATGCAGCGTCCGCGCCATCCTCGACGCCAACCGCAACGCC
CTCATGCTCCTGGACCTCAAGTTCAGCGTCGGCACCCTCGGCCTCGCAATGGGAACCTTTGTCGCGGGCCTCTAC
GGCATGAACCTGGAGAACTTCATCGAGGAGTCGCAGGTGGGCTTCGCTCTGGTGGCGGGCGCCTCGGCGGCCATG
TCGCTGCTGGTCTGCTGGTACGGGCTGGCCAAGCTGCGGCGGACGCAGCGCATCAAGATGATGATGGGCGGACAC
GAATCTTCGCGGGTCCCTCGCAGCTTGACGTTTCGGGATGACGGGGCGTTGGGCGTGTTGGATTCGAGGAATAGG
GAGTTTTTGAGGAGGGCTCAGATGCAGAGGGCCAGCATGATGGTGAAGAAGCCTTGGTGGAGGTGA
Gene >Ophun1|4507
ATGCAACCGGCGCCCCGACCAGCAGTCCCTCGCCTCTTCCGATTCCTCCAGCCGCGAGGGCAGGTCTGGCGCGGG
CCTGGCAGCTCTCTGCGCTGGGATCCGCGCCGGTTCGACGGGTTGCTTCTGTGCTGCTGCCGCTACCATGACTGC
GGCTCCGGTTCGGTGCATGACAAGACGGCGGCGGCGACGACGACGACGGGGAGCTGGAAGGATAGGCTGCTGAGC
TACGGTAATGGCGGTGGCGGTGGTGGTGGTGGTGGAGGTGGTGCGAGGTCCTGCGCTGGGTCGCTGCGGGATGAG
TTTGCGCCGGGGGGGTCGTCCATGTTTAACAGTCGGAGGGTGATGACGGCCAAGGCGGCGTTGGAGCCCATGCTG
CGATGTACCGAGGTGGACGAGAATGGCAAGGCGATCCTTACGGATGGGGAGTTTAAGAAGACGGAGTTGATTGCA
AAGGTGAGATTACCATCTCTTCTTTCTTTTGTTCTTCCGTGTGGCTGGTCGGCTGCAAGCGGGTTTTGACGAGAG
CTGAGAAGAGACGACGACGACAATCTCAATCATGTATAGTTTGGTCTTTTGCCTCGCGATCTGCGCAAGATTGAC
TCGTCCAATCTGCCTCACATCCTGGTCCGGCCATCGGCCATCCTCCTCAACCTGCTGCACCTCAAGGTGCTGATC
AAGCACGACCGCGTCTTCCTCTTCGACGTACACGGATCCAAAGAGTCGTGGCCGCAGTCGGCCTTTATGCACGAC
CTCAAGAACAAGCTGGAGCAGCAGCCGAAGCCGTCGCAGGGTCCCAACGGACTACCGTACGAGTTCCGCGCCCTC
GAGGCGACGCTCATGTCGGTCACGTCGGAGATGGAGGCCGAGTTCGAGTCGGTGCGCGAGCCGGTTATGCATATC
CTCAGCGAGCTCGAGGACGACATCGATCGCGATAAGCTGCGGATGCTGCTGATCCTGTCCAAGCGCATCAGCACG
TTTGAGCAGAAGTCGAAGCTGGTGCGCGATGCTATCGAGGAGTTGCTCGAGGCGGATGACGACTTGTCGGCCATG
TACCTCACCGAGAAGGCGGGAGGGACGAGGCAGCGACGCGGCAACGATGATCATACCGAGGTGGAGATGCTGCTG
GAATCCTATCACAAGCTCACCGACGAGATTGTGCAGGAGGCGGGCAACCTGGTATCCGGGATACGGAACACGGAG
GAGATGTGGGAGACTGCCCCCCCCGTTGTCTTTGATTTCGAAAAGCAAGTTCGGCTAACAAAAGACGTGCCATGC
AGCGTCCGCGCCATCCTCGACGCCAACCGCAACGCCCTCATGCTCCTGGACCTCAAGTTCAGCGTCGGCACCCTC
GGCCTCGCAATGGGAACCTTTGTCGCGGGCCTCTACGGCATGAACCTGGAGAACTTCATCGAGGAGTCGCAGGTG
GGCTTCGCTCTGGTGGCGGGCGCCTCGGCGGCCATGTCGCTGCTGGTCTGCTGGTACGGGCTGGCCAAGCTGCGG
CGGACGCAGCGCATCAAGATGATGATGGGCGGACACGAATCTTCGCGGGTCCCTCGCAGCTTGACGTTTCGGGAT
GACGGGGCGTTGGGCGTGTTGGATTCGAGGAATAGGGAGTTTTTGAGGAGGGCTCAGATGCAGAGGGCCAGCATG
ATGGTGAAGAAGCCTTGGTGGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail