Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|45
Gene name
LocationContig_1:119975..120625
Strand-
Gene length (bp)650
Transcript length (bp)591
Coding sequence length (bp)591
Protein length (aa) 197

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 2.9E-04 122 167

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 3 166 3.0E-06
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 41 166 6.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 25 0.999591

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5815
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|603
Ophiocordyceps australis 1348a (Ghana) OphauG2|6858
Ophiocordyceps australis map64 (Brazil) OphauB2|1402
Ophiocordyceps camponoti-floridani Ophcf2|04788
Ophiocordyceps camponoti-rufipedis Ophun1|45 (this protein)
Ophiocordyceps kimflemingae Ophio5|830

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|45
MAKVCLTHAIFLSSFALTFSALGHAAPSLREFPSGSAGEVNCDGWYRYATVRPYEELLRDLAVSSEDFRKLNPSI
GPRGQGLIPGNYYCTQSRPTDGPGNDLHRRQRQRQKKPYKPSCQSHYRIQAGDTCNYVQVLYGITAEELFDMNPF
VEDECEFLRAGWVLCVPKQKGVFKYGLSGLSVKMGAAGGGEASDPL*
Coding >Ophun1|45
ATGGCTAAAGTTTGTCTCACTCACGCCATCTTTCTGAGCAGTTTTGCCCTTACCTTCTCGGCCCTTGGTCATGCT
GCTCCCAGCTTGAGAGAGTTTCCGTCCGGTTCCGCAGGGGAGGTTAACTGTGATGGTTGGTATCGATACGCGACG
GTGCGGCCTTATGAGGAGCTTCTTAGAGACTTGGCCGTCAGTTCCGAAGACTTCCGAAAACTCAATCCGAGCATT
GGGCCTCGGGGGCAGGGTCTGATTCCCGGCAACTACTACTGCACCCAAAGTCGGCCGACGGACGGGCCTGGAAAC
GATTTACACCGACGCCAGAGACAGCGGCAGAAGAAGCCTTACAAACCGAGTTGCCAATCTCACTACCGTATCCAG
GCTGGTGATACATGCAATTATGTCCAGGTTCTGTACGGCATTACGGCCGAGGAGCTTTTCGACATGAATCCTTTT
GTTGAGGACGAGTGTGAGTTCTTGAGAGCGGGCTGGGTGCTTTGCGTTCCGAAACAGAAGGGAGTGTTTAAGTAT
GGGCTCAGTGGGTTGAGTGTTAAAATGGGAGCTGCTGGTGGTGGTGAAGCGAGTGATCCGTTGTAG
Transcript >Ophun1|45
ATGGCTAAAGTTTGTCTCACTCACGCCATCTTTCTGAGCAGTTTTGCCCTTACCTTCTCGGCCCTTGGTCATGCT
GCTCCCAGCTTGAGAGAGTTTCCGTCCGGTTCCGCAGGGGAGGTTAACTGTGATGGTTGGTATCGATACGCGACG
GTGCGGCCTTATGAGGAGCTTCTTAGAGACTTGGCCGTCAGTTCCGAAGACTTCCGAAAACTCAATCCGAGCATT
GGGCCTCGGGGGCAGGGTCTGATTCCCGGCAACTACTACTGCACCCAAAGTCGGCCGACGGACGGGCCTGGAAAC
GATTTACACCGACGCCAGAGACAGCGGCAGAAGAAGCCTTACAAACCGAGTTGCCAATCTCACTACCGTATCCAG
GCTGGTGATACATGCAATTATGTCCAGGTTCTGTACGGCATTACGGCCGAGGAGCTTTTCGACATGAATCCTTTT
GTTGAGGACGAGTGTGAGTTCTTGAGAGCGGGCTGGGTGCTTTGCGTTCCGAAACAGAAGGGAGTGTTTAAGTAT
GGGCTCAGTGGGTTGAGTGTTAAAATGGGAGCTGCTGGTGGTGGTGAAGCGAGTGATCCGTTGTAG
Gene >Ophun1|45
ATGGCTAAAGTTTGTCTCACTCACGCCATCTTTCTGAGCAGTTTTGCCCTTACCTTCTCGGCCCTTGGTCATGCT
GCTCCCAGCTTGAGAGAGTTTCCGTCCGGTTCCGCAGGGGAGGTTAACTGTGATGGTTGGTATCGATACGCGACG
GTGCGGCCTTATGAGGAGCTTCTTAGAGACTTGGCCGTCAGTTCCGAAGACTTCCGAAAACTCGTCAGTTCTGTC
TTCTCTTCTCGTTCCGGCTGAGGCATGCAGCTGAGACCGTATTGCAGAATCCGAGCATTGGGCCTCGGGGGCAGG
GTCTGATTCCCGGCAACTACTACTGCACCCAAAGTCGGCCGACGGACGGGCCTGGAAACGATTTACACCGACGCC
AGAGACAGCGGCAGAAGAAGCCTTACAAACCGAGTTGCCAATCTCACTACCGTATCCAGGCTGGTGATACATGCA
ATTATGTCCAGGTTCTGTACGGCATTACGGCCGAGGAGCTTTTCGACATGAATCCTTTTGTTGAGGACGAGTGTG
AGTTCTTGAGAGCGGGCTGGGTGCTTTGCGTTCCGAAACAGAAGGGAGTGTTTAAGTATGGGCTCAGTGGGTTGA
GTGTTAAAATGGGAGCTGCTGGTGGTGGTGAAGCGAGTGATCCGTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail