Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4495
Gene name
LocationContig_416:307..777
Strand+
Gene length (bp)470
Transcript length (bp)414
Coding sequence length (bp)414
Protein length (aa) 138

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family 4.3E-20 70 131

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54GD8|PX24C_DICDI PXMP2/4 family protein 3 OS=Dictyostelium discoideum GN=DDB_G0290223 PE=3 SV=1 43 136 3.0E-12
sp|Q9V492|MPV17_DROME Mpv17-like protein OS=Drosophila melanogaster GN=CG11077 PE=2 SV=1 30 133 1.0E-09
sp|Q7YWV6|MPV17_CAEEL Mpv17-like protein OS=Caenorhabditis elegans GN=T18D3.9 PE=3 SV=1 62 136 1.0E-07
sp|Q66GV0|MPV17_XENLA Protein Mpv17 OS=Xenopus laevis GN=mpv17 PE=2 SV=2 65 136 5.0E-07
sp|P19258|MPV17_MOUSE Protein Mpv17 OS=Mus musculus GN=Mpv17 PE=1 SV=1 65 131 5.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54GD8|PX24C_DICDI PXMP2/4 family protein 3 OS=Dictyostelium discoideum GN=DDB_G0290223 PE=3 SV=1 43 136 3.0E-12
sp|Q9V492|MPV17_DROME Mpv17-like protein OS=Drosophila melanogaster GN=CG11077 PE=2 SV=1 30 133 1.0E-09
sp|Q7YWV6|MPV17_CAEEL Mpv17-like protein OS=Caenorhabditis elegans GN=T18D3.9 PE=3 SV=1 62 136 1.0E-07
sp|Q66GV0|MPV17_XENLA Protein Mpv17 OS=Xenopus laevis GN=mpv17 PE=2 SV=2 65 136 5.0E-07
sp|P19258|MPV17_MOUSE Protein Mpv17 OS=Mus musculus GN=Mpv17 PE=1 SV=1 65 131 5.0E-06
sp|Q5BK62|MPV17_RAT Protein Mpv17 OS=Rattus norvegicus GN=Mpv17 PE=2 SV=1 65 137 6.0E-06
sp|P39210|MPV17_HUMAN Protein Mpv17 OS=Homo sapiens GN=MPV17 PE=1 SV=1 65 137 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 87 109 22
3 116 135 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4495
MWQQFLERCFPSHPRPSTPTTTFELKAAEEAAPPPTARPLSLFNTATKWFVDCITMGALANTVAFLVLMGLLKGQ
PALRIWDNVRSETIPIIIAGYKIWPLASVISFSFVPVHRRVVFLSFVGLLWGIYMSLVAARV*
Coding >Ophun1|4495
ATGTGGCAGCAGTTTCTAGAGCGCTGCTTCCCCTCGCACCCGCGTCCTTCAACCCCGACCACCACCTTTGAGCTC
AAGGCGGCTGAAGAGGCCGCTCCGCCGCCGACAGCCCGGCCGCTGAGCCTCTTCAATACCGCTACCAAGTGGTTC
GTCGACTGCATCACCATGGGCGCTCTGGCCAATACCGTTGCCTTCTTGGTGCTCATGGGCTTGCTCAAGGGTCAG
CCTGCGCTGCGCATCTGGGATAACGTCCGCTCAGAAACGATACCCATCATCATCGCCGGCTACAAGATCTGGCCG
CTGGCTTCCGTCATCAGCTTCTCCTTCGTGCCCGTCCATCGGCGCGTCGTCTTCCTCAGCTTCGTCGGCCTGCTG
TGGGGGATCTACATGAGTCTCGTCGCCGCGCGTGTCTAG
Transcript >Ophun1|4495
ATGTGGCAGCAGTTTCTAGAGCGCTGCTTCCCCTCGCACCCGCGTCCTTCAACCCCGACCACCACCTTTGAGCTC
AAGGCGGCTGAAGAGGCCGCTCCGCCGCCGACAGCCCGGCCGCTGAGCCTCTTCAATACCGCTACCAAGTGGTTC
GTCGACTGCATCACCATGGGCGCTCTGGCCAATACCGTTGCCTTCTTGGTGCTCATGGGCTTGCTCAAGGGTCAG
CCTGCGCTGCGCATCTGGGATAACGTCCGCTCAGAAACGATACCCATCATCATCGCCGGCTACAAGATCTGGCCG
CTGGCTTCCGTCATCAGCTTCTCCTTCGTGCCCGTCCATCGGCGCGTCGTCTTCCTCAGCTTCGTCGGCCTGCTG
TGGGGGATCTACATGAGTCTCGTCGCCGCGCGTGTCTAG
Gene >Ophun1|4495
ATGTGGCAGCAGTTTCTAGAGCGCTGCTTCCCCTCGCACCCGCGTCCTTCAACCCCGACCACCACCTTTGAGCTC
AAGGCGGCTGAAGAGGCCGCTCCGCCGCCGACAGCCCGGCCGCTGAGCCTCTTCAATACCGCTACCAAGTGGTTC
GTCGACTGCATCACCATGGGCGCTCTGGCCAATACCGTTGCCTTCTTGGTGCTCATGGGCTTGCTCAAGGGTCAG
CCTGCGCTGCGCATCTGGGATAACGTCCGCTCAGTGCGTCAAGAGTCCAATGCCCCAGCTCTGAAGCTTGAGAGC
TGACCTTGTAGCAGGAAACGATACCCATCATCATCGCCGGCTACAAGATCTGGCCGCTGGCTTCCGTCATCAGCT
TCTCCTTCGTGCCCGTCCATCGGCGCGTCGTCTTCCTCAGCTTCGTCGGCCTGCTGTGGGGGATCTACATGAGTC
TCGTCGCCGCGCGTGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail