Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4494
Gene name
LocationContig_415:13064..15714
Strand+
Gene length (bp)2650
Transcript length (bp)2457
Coding sequence length (bp)2457
Protein length (aa) 819

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06472 ABC_membrane_2 ABC transporter transmembrane region 2 4.0E-93 152 422
PF00005 ABC_tran ABC transporter 7.8E-16 548 693

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41909|PXA1_YEAST Peroxisomal long-chain fatty acid import protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PXA1 PE=1 SV=2 145 788 1.0E-164
sp|Q61285|ABCD2_MOUSE ATP-binding cassette sub-family D member 2 OS=Mus musculus GN=Abcd2 PE=1 SV=1 139 781 4.0E-154
sp|Q9UBJ2|ABCD2_HUMAN ATP-binding cassette sub-family D member 2 OS=Homo sapiens GN=ABCD2 PE=1 SV=1 139 781 2.0E-151
sp|P48410|ABCD1_MOUSE ATP-binding cassette sub-family D member 1 OS=Mus musculus GN=Abcd1 PE=1 SV=1 134 785 2.0E-151
sp|Q9QY44|ABCD2_RAT ATP-binding cassette sub-family D member 2 OS=Rattus norvegicus GN=Abcd2 PE=1 SV=1 139 781 8.0E-150
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41909|PXA1_YEAST Peroxisomal long-chain fatty acid import protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PXA1 PE=1 SV=2 145 788 1.0E-164
sp|Q61285|ABCD2_MOUSE ATP-binding cassette sub-family D member 2 OS=Mus musculus GN=Abcd2 PE=1 SV=1 139 781 4.0E-154
sp|Q9UBJ2|ABCD2_HUMAN ATP-binding cassette sub-family D member 2 OS=Homo sapiens GN=ABCD2 PE=1 SV=1 139 781 2.0E-151
sp|P48410|ABCD1_MOUSE ATP-binding cassette sub-family D member 1 OS=Mus musculus GN=Abcd1 PE=1 SV=1 134 785 2.0E-151
sp|Q9QY44|ABCD2_RAT ATP-binding cassette sub-family D member 2 OS=Rattus norvegicus GN=Abcd2 PE=1 SV=1 139 781 8.0E-150
sp|P33897|ABCD1_HUMAN ATP-binding cassette sub-family D member 1 OS=Homo sapiens GN=ABCD1 PE=1 SV=2 135 800 9.0E-149
sp|P55096|ABCD3_MOUSE ATP-binding cassette sub-family D member 3 OS=Mus musculus GN=Abcd3 PE=1 SV=2 144 748 7.0E-122
sp|P28288|ABCD3_HUMAN ATP-binding cassette sub-family D member 3 OS=Homo sapiens GN=ABCD3 PE=1 SV=1 144 748 9.0E-122
sp|P16970|ABCD3_RAT ATP-binding cassette sub-family D member 3 OS=Rattus norvegicus GN=Abcd3 PE=1 SV=3 144 748 1.0E-121
sp|Q8T8P3|ABCD2_DICDI ABC transporter D family member 2 OS=Dictyostelium discoideum GN=abcD2 PE=3 SV=1 141 756 4.0E-113
sp|P34230|PXA2_YEAST Peroxisomal long-chain fatty acid import protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PXA2 PE=1 SV=1 167 777 5.0E-73
sp|Q94FB9|AB1D_ARATH ABC transporter D family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 151 748 6.0E-72
sp|Q94FB9|AB1D_ARATH ABC transporter D family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 152 743 2.0E-69
sp|O14678|ABCD4_HUMAN ATP-binding cassette sub-family D member 4 OS=Homo sapiens GN=ABCD4 PE=1 SV=1 130 751 3.0E-67
sp|O89016|ABCD4_MOUSE ATP-binding cassette sub-family D member 4 OS=Mus musculus GN=Abcd4 PE=1 SV=2 130 751 5.0E-65
sp|Q6NLC1|AB2D_ARATH ABC transporter D family member 2, chloroplastic OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=1 212 751 3.0E-50
sp|Q55774|Y182_SYNY3 Uncharacterized ABC transporter ATP-binding protein sll0182 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0182 PE=3 SV=1 226 728 3.0E-40
sp|Q54W20|ABCD3_DICDI ABC transporter D family member 3 OS=Dictyostelium discoideum GN=abcD3 PE=3 SV=1 413 746 1.0E-39
sp|Q54W19|ABCD1_DICDI ABC transporter D family member 1 OS=Dictyostelium discoideum GN=abcD1 PE=3 SV=1 460 729 9.0E-39
sp|Q57335|Y036_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0036 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0036 PE=3 SV=1 158 734 2.0E-31
sp|P45221|Y1467_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1467 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1467 PE=3 SV=1 260 729 1.0E-28
sp|P9WQI9|BACA_MYCTU Vitamin B12 transport ATP-binding protein BacA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bacA PE=1 SV=1 543 737 2.0E-26
sp|P9WQI8|BACA_MYCTO Vitamin B12 transport ATP-binding protein BacA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bacA PE=3 SV=1 543 737 2.0E-26
sp|P31826|YDDA_ECOLI Inner membrane ABC transporter ATP-binding protein YddA OS=Escherichia coli (strain K12) GN=yddA PE=1 SV=2 205 717 2.0E-19
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 459 744 5.0E-16
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 460 726 7.0E-16
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 542 723 3.0E-12
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 527 793 6.0E-12
sp|Q9X2W0|MCJD_ECOLX Microcin-J25 export ATP-binding/permease protein McjD OS=Escherichia coli GN=mcjD PE=1 SV=1 545 696 1.0E-11
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 491 708 1.0E-11
sp|O59479|Y1815_PYRHO Putative ABC transporter ATP-binding protein PH1815 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1815 PE=3 SV=1 548 734 1.0E-11
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 452 755 1.0E-11
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 544 719 3.0E-11
sp|Q6A6X6|METN_PROAC Methionine import ATP-binding protein MetN OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=metN PE=3 SV=1 525 719 5.0E-11
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 517 723 5.0E-11
sp|Q54W19|ABCD1_DICDI ABC transporter D family member 1 OS=Dictyostelium discoideum GN=abcD1 PE=3 SV=1 144 380 6.0E-11
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 409 756 6.0E-11
sp|Q54W20|ABCD3_DICDI ABC transporter D family member 3 OS=Dictyostelium discoideum GN=abcD3 PE=3 SV=1 178 367 8.0E-11
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 543 701 8.0E-11
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 543 701 8.0E-11
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 543 701 8.0E-11
sp|Q9C9W0|AB17I_ARATH ABC transporter I family member 17 OS=Arabidopsis thaliana GN=ABCI17 PE=2 SV=1 525 719 8.0E-11
sp|Q9V1Q4|Y373_PYRAB Putative ABC transporter ATP-binding protein PYRAB03730 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB03730 PE=3 SV=1 548 734 1.0E-10
sp|Q4ZRT7|PSTB1_PSEU2 Phosphate import ATP-binding protein PstB 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pstB1 PE=3 SV=1 543 758 1.0E-10
sp|Q880A6|PSTB1_PSESM Phosphate import ATP-binding protein PstB 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pstB1 PE=3 SV=1 543 758 1.0E-10
sp|Q48HD9|PSTB1_PSE14 Phosphate import ATP-binding protein PstB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pstB1 PE=3 SV=1 543 758 1.0E-10
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 547 740 1.0E-10
sp|Q7ANN4|PRSD_RHIME Type I secretion system ATP-binding protein PrsD OS=Rhizobium meliloti (strain 1021) GN=prsD PE=1 SV=2 541 771 2.0E-10
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 541 717 2.0E-10
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 511 723 2.0E-10
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 540 717 2.0E-10
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 519 740 2.0E-10
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 472 735 3.0E-10
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 543 726 3.0E-10
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 547 723 3.0E-10
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 438 719 3.0E-10
sp|Q0S0X2|SSUB3_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Rhodococcus jostii (strain RHA1) GN=ssuB3 PE=3 SV=1 543 698 3.0E-10
sp|Q89ER4|SSUB_BRADU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ssuB PE=3 SV=1 543 719 4.0E-10
sp|A0KPH6|ZNUC_AERHH Zinc import ATP-binding protein ZnuC OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=znuC PE=3 SV=1 544 702 4.0E-10
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 527 761 4.0E-10
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 482 721 5.0E-10
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 538 762 5.0E-10
sp|Q8NR42|SSUB_CORGL Aliphatic sulfonates import ATP-binding protein SsuB OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ssuB PE=1 SV=1 543 739 6.0E-10
sp|O34946|ZNUC_BACSU High-affinity zinc uptake system ATP-binding protein ZnuC OS=Bacillus subtilis (strain 168) GN=znuC PE=1 SV=1 547 706 7.0E-10
sp|Q8U8D6|SSUB1_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB1 PE=3 SV=1 543 698 7.0E-10
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 452 721 8.0E-10
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 547 757 8.0E-10
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 512 726 9.0E-10
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 542 738 9.0E-10
sp|Q1AXT9|PSTB_RUBXD Phosphate import ATP-binding protein PstB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pstB PE=3 SV=1 548 758 1.0E-09
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 544 723 1.0E-09
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 546 803 1.0E-09
sp|Q7N545|ZNUC_PHOLL Zinc import ATP-binding protein ZnuC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=znuC PE=3 SV=2 543 706 1.0E-09
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 524 721 1.0E-09
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 540 706 1.0E-09
sp|Q6LTB1|ZNUC_PHOPR Zinc import ATP-binding protein ZnuC OS=Photobacterium profundum GN=znuC PE=3 SV=1 543 704 1.0E-09
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 527 767 1.0E-09
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 512 726 1.0E-09
sp|Q03EE4|ECFA_PEDPA Energy-coupling factor transporter ATP-binding protein EcfA OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=ecfA PE=3 SV=1 543 723 1.0E-09
sp|Q4L5B3|POTA_STAHJ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=potA PE=3 SV=1 547 719 1.0E-09
sp|Q66AT7|ZNUC_YERPS Zinc import ATP-binding protein ZnuC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=znuC PE=3 SV=1 543 738 2.0E-09
sp|Q1CJG3|ZNUC_YERPN Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=znuC PE=3 SV=1 543 738 2.0E-09
sp|Q7CIC2|ZNUC_YERPE Zinc import ATP-binding protein ZnuC OS=Yersinia pestis GN=znuC PE=3 SV=1 543 738 2.0E-09
sp|Q1C812|ZNUC_YERPA Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=znuC PE=3 SV=1 543 738 2.0E-09
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 499 740 2.0E-09
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 548 726 2.0E-09
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 547 739 2.0E-09
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 514 706 2.0E-09
sp|Q4L8L7|HRTA_STAHJ Putative hemin import ATP-binding protein HrtA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hrtA PE=3 SV=1 546 699 2.0E-09
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 512 723 2.0E-09
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 548 727 2.0E-09
sp|P77279|FETA_ECOLI Probable iron export ATP-binding protein FetA OS=Escherichia coli (strain K12) GN=fetA PE=1 SV=1 543 719 2.0E-09
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 527 726 2.0E-09
sp|O32169|METN_BACSU Methionine import ATP-binding protein MetN OS=Bacillus subtilis (strain 168) GN=metN PE=1 SV=1 548 719 2.0E-09
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 527 764 3.0E-09
sp|Q65M64|SSUB_BACLD Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ssuB PE=3 SV=1 547 719 3.0E-09
sp|A0KE71|SSUB2_BURCH Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Burkholderia cenocepacia (strain HI2424) GN=ssuB2 PE=3 SV=1 543 698 3.0E-09
sp|Q1BG75|SSUB2_BURCA Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=ssuB2 PE=3 SV=1 543 698 3.0E-09
sp|Q9Z3I3|NODI_BRASS Nod factor export ATP-binding protein I OS=Bradyrhizobium sp. (strain SNU001) GN=nodI PE=3 SV=1 543 706 3.0E-09
sp|Q60350|Y035_METJA Uncharacterized ABC transporter ATP-binding protein MJ0035 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0035 PE=3 SV=1 542 727 3.0E-09
sp|Q32HA3|ZNUC_SHIDS Zinc import ATP-binding protein ZnuC OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=znuC PE=3 SV=1 543 706 3.0E-09
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 512 726 3.0E-09
sp|Q8KLG1|NODI_RHIEC Nod factor export ATP-binding protein I OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nodI PE=3 SV=3 543 716 3.0E-09
sp|Q3Z2L6|ZNUC_SHISS Zinc import ATP-binding protein ZnuC OS=Shigella sonnei (strain Ss046) GN=znuC PE=3 SV=1 543 706 3.0E-09
sp|Q322E8|ZNUC_SHIBS Zinc import ATP-binding protein ZnuC OS=Shigella boydii serotype 4 (strain Sb227) GN=znuC PE=3 SV=1 543 706 3.0E-09
sp|Q1RAS6|ZNUC_ECOUT Zinc import ATP-binding protein ZnuC OS=Escherichia coli (strain UTI89 / UPEC) GN=znuC PE=3 SV=1 543 706 3.0E-09
sp|P0A9X1|ZNUC_ECOLI Zinc import ATP-binding protein ZnuC OS=Escherichia coli (strain K12) GN=znuC PE=1 SV=1 543 706 3.0E-09
sp|P0A9X2|ZNUC_ECOL6 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=znuC PE=3 SV=1 543 706 3.0E-09
sp|Q0TGX4|ZNUC_ECOL5 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=znuC PE=3 SV=1 543 706 3.0E-09
sp|A1AC19|ZNUC_ECOK1 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O1:K1 / APEC GN=znuC PE=3 SV=1 543 706 3.0E-09
sp|P0A9X3|ZNUC_ECO57 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O157:H7 GN=znuC PE=3 SV=1 543 706 3.0E-09
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 512 726 3.0E-09
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 512 726 3.0E-09
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 512 726 3.0E-09
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 512 726 3.0E-09
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 543 746 4.0E-09
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 512 726 4.0E-09
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 512 726 4.0E-09
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 467 738 4.0E-09
sp|P94374|YXLF_BACSU Uncharacterized ABC transporter ATP-binding protein YxlF OS=Bacillus subtilis (strain 168) GN=yxlF PE=2 SV=1 546 696 4.0E-09
sp|Q65F80|METN2_BACLD Methionine import ATP-binding protein MetN 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metN2 PE=3 SV=1 548 719 4.0E-09
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 512 726 4.0E-09
sp|Q665B6|SSUB_YERPS Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ssuB PE=3 SV=1 543 719 4.0E-09
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 547 723 4.0E-09
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 558 708 5.0E-09
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 547 723 5.0E-09
sp|Q6D4A8|ZNUC_PECAS Zinc import ATP-binding protein ZnuC OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=znuC PE=3 SV=1 543 706 5.0E-09
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 511 707 5.0E-09
sp|P33116|SPAT_BACIU Subtilin transport ATP-binding protein SpaT OS=Bacillus subtilis GN=spaT PE=3 SV=1 467 707 5.0E-09
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 547 737 5.0E-09
sp|Q5PIA5|ZNUC_SALPA Zinc import ATP-binding protein ZnuC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=znuC PE=3 SV=1 543 706 5.0E-09
sp|Q57NA5|ZNUC_SALCH Zinc import ATP-binding protein ZnuC OS=Salmonella choleraesuis (strain SC-B67) GN=znuC PE=3 SV=2 543 706 5.0E-09
sp|Q07756|NODI_AZOC5 Nod factor export ATP-binding protein I OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodI PE=3 SV=1 531 719 5.0E-09
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 512 726 5.0E-09
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 548 763 5.0E-09
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 502 723 6.0E-09
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 544 724 6.0E-09
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 546 719 7.0E-09
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 520 755 7.0E-09
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 517 723 7.0E-09
sp|Q5HQ70|POTA_STAEQ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=potA PE=3 SV=1 546 719 7.0E-09
sp|Q7NWX3|CYSA2_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA2 PE=3 SV=1 548 709 7.0E-09
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 524 726 8.0E-09
sp|P47546|Y304_MYCGE Putative ABC transporter ATP-binding protein MG304 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG304 PE=3 SV=1 547 731 8.0E-09
sp|Q8Z5W6|ZNUC_SALTI Zinc import ATP-binding protein ZnuC OS=Salmonella typhi GN=znuC PE=3 SV=1 543 706 8.0E-09
sp|A0B344|METN2_BURCH Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain HI2424) GN=metN2 PE=3 SV=1 541 719 8.0E-09
sp|Q1BR30|METN2_BURCA Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN2 PE=3 SV=1 541 719 8.0E-09
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 512 726 8.0E-09
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 543 710 8.0E-09
sp|Q83KR7|ZNUC_SHIFL Zinc import ATP-binding protein ZnuC OS=Shigella flexneri GN=znuC PE=3 SV=1 543 706 9.0E-09
sp|Q0T3U8|ZNUC_SHIF8 Zinc import ATP-binding protein ZnuC OS=Shigella flexneri serotype 5b (strain 8401) GN=znuC PE=3 SV=1 543 706 9.0E-09
sp|Q0K9I2|SSUB_CUPNH Aliphatic sulfonates import ATP-binding protein SsuB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ssuB PE=3 SV=1 544 719 9.0E-09
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 527 710 9.0E-09
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 467 723 1.0E-08
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 502 723 1.0E-08
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 547 723 1.0E-08
sp|Q8GNH6|NODI_RHIML Nod factor export ATP-binding protein I OS=Rhizobium meliloti GN=nodI PE=3 SV=1 543 716 1.0E-08
sp|Q8FRX8|METN_COREF Methionine import ATP-binding protein MetN OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metN PE=3 SV=1 548 784 1.0E-08
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 547 737 1.0E-08
sp|Q0B6I6|METN2_BURCM Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1 541 719 1.0E-08
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 543 706 1.0E-08
sp|Q98DT6|SSUB1_RHILO Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Rhizobium loti (strain MAFF303099) GN=ssuB1 PE=3 SV=1 543 698 1.0E-08
sp|Q6NBT1|CYSA_RHOPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cysA PE=3 SV=1 548 700 1.0E-08
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 548 708 1.0E-08
sp|Q3IWB5|ZNUC_RHOS4 Zinc import ATP-binding protein ZnuC OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=znuC PE=3 SV=1 542 738 1.0E-08
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 529 740 1.0E-08
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 512 726 1.0E-08
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 547 708 1.0E-08
sp|Q39AT4|METN2_BURL3 Methionine import ATP-binding protein MetN 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN2 PE=3 SV=1 541 719 1.0E-08
sp|Q8ZNV7|ZNUC_SALTY Zinc import ATP-binding protein ZnuC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=znuC PE=2 SV=2 543 706 1.0E-08
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 540 706 1.0E-08
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 546 786 2.0E-08
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 544 724 2.0E-08
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 547 745 2.0E-08
sp|O34314|YTLC_BACSU Uncharacterized ABC transporter ATP-binding protein YtlC OS=Bacillus subtilis (strain 168) GN=ytlC PE=3 SV=1 556 719 2.0E-08
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 512 726 2.0E-08
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 512 726 2.0E-08
sp|Q2RFS8|ECFA_MOOTA Energy-coupling factor transporter ATP-binding protein EcfA OS=Moorella thermoacetica (strain ATCC 39073) GN=ecfA PE=3 SV=1 539 719 2.0E-08
sp|A0AGP9|POTA_LISW6 Spermidine/putrescine import ATP-binding protein PotA OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=potA PE=3 SV=1 527 719 2.0E-08
sp|Q8G838|Y043_BIFLO Putative ABC transporter ATP-binding protein BL0043 OS=Bifidobacterium longum (strain NCC 2705) GN=BL0043 PE=3 SV=2 540 719 2.0E-08
sp|Q8XHV2|ECFA1_CLOPE Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Clostridium perfringens (strain 13 / Type A) GN=ecfA1 PE=3 SV=1 548 719 2.0E-08
sp|Q0TMS7|ECFA1_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA1 PE=3 SV=1 548 719 2.0E-08
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 529 723 2.0E-08
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 546 786 2.0E-08
sp|Q1CDR0|SSUB_YERPN Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ssuB PE=3 SV=1 543 719 2.0E-08
sp|Q74PI5|SSUB_YERPE Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis GN=ssuB PE=3 SV=1 543 719 2.0E-08
sp|Q1C1S0|SSUB_YERPA Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ssuB PE=3 SV=1 543 719 2.0E-08
sp|Q6FFZ1|SSUB_ACIAD Aliphatic sulfonates import ATP-binding protein SsuB OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ssuB PE=3 SV=1 543 723 2.0E-08
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 511 793 2.0E-08
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 527 721 2.0E-08
sp|Q92DL6|POTA_LISIN Spermidine/putrescine import ATP-binding protein PotA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=potA PE=3 SV=2 527 719 2.0E-08
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 524 723 2.0E-08
sp|Q0SRL2|POTA_CLOPS Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain SM101 / Type A) GN=potA PE=3 SV=2 543 719 2.0E-08
sp|Q65S66|FBPC_MANSM Fe(3+) ions import ATP-binding protein FbpC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fbpC PE=3 SV=2 543 710 2.0E-08
sp|Q3M5J9|SSUB_ANAVT Aliphatic sulfonates import ATP-binding protein SsuB OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ssuB PE=3 SV=1 543 719 2.0E-08
sp|Q5PB72|ZNUC_ANAMM Zinc import ATP-binding protein ZnuC OS=Anaplasma marginale (strain St. Maries) GN=znuC PE=3 SV=1 545 738 2.0E-08
sp|Q38VW6|POTA_LACSS Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=potA PE=3 SV=1 546 719 2.0E-08
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 467 723 3.0E-08
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 512 726 3.0E-08
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 545 719 3.0E-08
sp|Q881U6|SSUB2_PSESM Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuB2 PE=3 SV=1 543 719 3.0E-08
sp|Q8U4K3|WTPC_PYRFU Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=wtpC PE=3 SV=1 548 738 3.0E-08
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 513 726 3.0E-08
sp|Q73GK9|ZNUC_WOLPM Zinc import ATP-binding protein ZnuC OS=Wolbachia pipientis wMel GN=znuC PE=3 SV=2 544 719 3.0E-08
sp|A1URR2|UGPC_BARBK sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ugpC PE=3 SV=1 547 761 3.0E-08
sp|Q0D9V6|STAR1_ORYSJ Protein STAR1 OS=Oryza sativa subsp. japonica GN=STAR1 PE=1 SV=1 544 719 3.0E-08
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 541 708 3.0E-08
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 540 738 3.0E-08
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 540 706 3.0E-08
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 546 723 3.0E-08
sp|Q8Y8T6|POTA_LISMO Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=potA PE=3 SV=2 527 719 3.0E-08
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 546 755 3.0E-08
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 507 709 3.0E-08
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 548 719 3.0E-08
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 547 723 3.0E-08
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 544 719 4.0E-08
sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein AprD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aprD PE=3 SV=1 541 724 4.0E-08
sp|Q0SQH5|ECFA1_CLOPS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA1 PE=3 SV=1 548 719 4.0E-08
sp|Q5YRD1|METN_NOCFA Methionine import ATP-binding protein MetN OS=Nocardia farcinica (strain IFM 10152) GN=metN PE=3 SV=1 547 738 4.0E-08
sp|Q03P57|METN_LACBA Methionine import ATP-binding protein MetN OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=metN PE=3 SV=1 548 719 4.0E-08
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 519 723 4.0E-08
sp|Q12NL5|LOLD_SHEDO Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lolD PE=3 SV=1 546 724 4.0E-08
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 520 710 4.0E-08
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 547 718 4.0E-08
sp|Q8CPN0|POTA_STAES Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=potA PE=3 SV=1 546 719 4.0E-08
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 519 723 4.0E-08
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 529 723 4.0E-08
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 527 741 4.0E-08
sp|P97027|SSUB_BACSU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus subtilis (strain 168) GN=ssuB PE=1 SV=4 547 719 4.0E-08
sp|P23703|NODI_RHILO Nod factor export ATP-binding protein I OS=Rhizobium loti (strain MAFF303099) GN=nodI PE=3 SV=2 512 716 4.0E-08
sp|Q39LW7|SSUB2_BURL3 Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ssuB2 PE=3 SV=1 543 783 4.0E-08
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 543 767 4.0E-08
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 547 723 5.0E-08
sp|Q3IM36|PSTB3_NATPD Phosphate import ATP-binding protein PstB 3 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pstB3 PE=3 SV=1 543 717 5.0E-08
sp|Q0SWH9|ECFA2_CLOPS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA2 PE=3 SV=1 544 716 5.0E-08
sp|Q8XIZ5|POTA_CLOPE Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain 13 / Type A) GN=potA PE=3 SV=1 543 719 5.0E-08
sp|Q0TNZ3|POTA_CLOP1 Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=potA PE=3 SV=1 543 719 5.0E-08
sp|Q2YAD6|POTA_NITMU Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=potA PE=3 SV=1 543 719 5.0E-08
sp|Q0SFW6|METN2_RHOJR Methionine import ATP-binding protein MetN 2 OS=Rhodococcus jostii (strain RHA1) GN=metN2 PE=3 SV=1 527 739 5.0E-08
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 544 737 5.0E-08
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 452 721 5.0E-08
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 540 706 6.0E-08
sp|P25885|Y382_RHIME Uncharacterized ABC transporter ATP-binding protein R00382 OS=Rhizobium meliloti (strain 1021) GN=R00382 PE=3 SV=1 547 724 6.0E-08
sp|Q03Z27|METN_LEUMM Methionine import ATP-binding protein MetN OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=metN PE=3 SV=1 546 719 6.0E-08
sp|Q8XNY7|Y195_CLOPE Putative ABC transporter ATP-binding protein CPE0195 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE0195 PE=3 SV=1 544 716 6.0E-08
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 514 733 6.0E-08
sp|P24137|OPPF_BACSU Oligopeptide transport ATP-binding protein OppF OS=Bacillus subtilis (strain 168) GN=oppF PE=2 SV=3 539 727 6.0E-08
sp|Q4KK46|METN2_PSEF5 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metN2 PE=3 SV=1 490 719 7.0E-08
sp|Q87UV4|METN1_PSESM Methionine import ATP-binding protein MetN 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metN1 PE=3 SV=2 542 719 7.0E-08
sp|O34677|GLNQ_BACSU Glutamine transport ATP-binding protein GlnQ OS=Bacillus subtilis (strain 168) GN=glnQ PE=2 SV=1 543 726 7.0E-08
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 511 793 7.0E-08
sp|Q0TUN8|ECFA3_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA3 PE=1 SV=1 544 734 7.0E-08
sp|Q9I1C8|METN1_PSEAE Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metN1 PE=3 SV=1 543 745 7.0E-08
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 519 723 7.0E-08
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 540 723 8.0E-08
sp|Q722B1|POTA_LISMF Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serotype 4b (strain F2365) GN=potA PE=3 SV=2 527 719 8.0E-08
sp|A0K739|SSUB1_BURCH Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Burkholderia cenocepacia (strain HI2424) GN=ssuB1 PE=3 SV=1 543 698 8.0E-08
sp|Q1BWL4|SSUB1_BURCA Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=ssuB1 PE=3 SV=1 543 698 8.0E-08
sp|Q8U4L3|Y068_PYRFU Putative ABC transporter ATP-binding protein PF0068 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0068 PE=3 SV=1 539 764 8.0E-08
sp|Q5LBT4|POTA_BACFN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1 543 719 8.0E-08
sp|Q64SQ6|POTA_BACFR Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2 543 719 8.0E-08
sp|Q9X051|RBSA2_THEMA Ribose import ATP-binding protein RbsA 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rbsA2 PE=3 SV=1 548 721 8.0E-08
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 547 710 8.0E-08
sp|Q5WKG4|SSUB1_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Bacillus clausii (strain KSM-K16) GN=ssuB1 PE=3 SV=1 543 719 8.0E-08
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 547 710 8.0E-08
sp|P36879|YADG_ECOLI Uncharacterized ABC transporter ATP-binding protein YadG OS=Escherichia coli (strain K12) GN=yadG PE=3 SV=1 543 792 9.0E-08
sp|Q02ME3|METN1_PSEAB Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN1 PE=3 SV=1 543 745 9.0E-08
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 548 787 9.0E-08
sp|Q65UE1|POTA_MANSM Spermidine/putrescine import ATP-binding protein PotA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=potA PE=3 SV=1 547 719 9.0E-08
sp|Q18C09|METN_PEPD6 Methionine import ATP-binding protein MetN OS=Peptoclostridium difficile (strain 630) GN=metN PE=3 SV=1 543 726 9.0E-08
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 546 786 1.0E-07
sp|Q2SPI3|ZNUC1_HAHCH Zinc import ATP-binding protein ZnuC 1 OS=Hahella chejuensis (strain KCTC 2396) GN=znuC1 PE=3 SV=1 544 705 1.0E-07
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 546 728 1.0E-07
sp|Q8G5P8|METN_BIFLO Methionine import ATP-binding protein MetN OS=Bifidobacterium longum (strain NCC 2705) GN=metN PE=3 SV=1 548 724 1.0E-07
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 551 806 1.0E-07
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 543 719 1.0E-07
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 431 733 1.0E-07
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 544 727 1.0E-07
sp|Q4A5A5|ECFA1_MYCS5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma synoviae (strain 53) GN=ecfA1 PE=3 SV=1 541 719 1.0E-07
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 547 706 1.0E-07
sp|Q7N8B9|FBPC_PHOLL Fe(3+) ions import ATP-binding protein FbpC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fbpC PE=3 SV=1 543 710 1.0E-07
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 546 737 1.0E-07
sp|Q830W6|POTA_ENTFA Spermidine/putrescine import ATP-binding protein PotA OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=potA PE=3 SV=1 545 719 1.0E-07
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 540 723 1.0E-07
sp|Q1LNM0|SSUB_CUPMC Aliphatic sulfonates import ATP-binding protein SsuB OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ssuB PE=3 SV=1 544 723 1.0E-07
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 542 723 1.0E-07
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 525 723 1.0E-07
sp|Q9PBK0|PSTB_XYLFA Phosphate import ATP-binding protein PstB OS=Xylella fastidiosa (strain 9a5c) GN=pstB PE=3 SV=1 565 758 1.0E-07
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 562 816 1.0E-07
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 548 700 1.0E-07
sp|P72335|NODI_RHIS3 Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain N33) GN=nodI PE=3 SV=1 543 716 1.0E-07
sp|Q9CL63|RBSA2_PASMU Ribose import ATP-binding protein RbsA 2 OS=Pasteurella multocida (strain Pm70) GN=rbsA2 PE=3 SV=1 522 723 1.0E-07
sp|O06476|YFMR_BACSU Uncharacterized ABC transporter ATP-binding protein YfmR OS=Bacillus subtilis (strain 168) GN=yfmR PE=3 SV=1 543 700 1.0E-07
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 548 817 1.0E-07
sp|Q13ZK7|SSUB1_BURXL Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Burkholderia xenovorans (strain LB400) GN=ssuB1 PE=3 SV=2 525 738 1.0E-07
sp|Q4A8A2|ECFA1_MYCH7 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma hyopneumoniae (strain 7448) GN=ecfA1 PE=3 SV=1 547 719 2.0E-07
sp|Q601T5|ECFA1_MYCH2 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma hyopneumoniae (strain 232) GN=ecfA1 PE=3 SV=1 547 719 2.0E-07
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 515 761 2.0E-07
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 544 737 2.0E-07
sp|Q8PP41|SSUB1_XANAC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB1 PE=3 SV=1 543 769 2.0E-07
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 425 723 2.0E-07
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 512 761 2.0E-07
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 548 726 2.0E-07
sp|Q9CM80|FBPC_PASMU Fe(3+) ions import ATP-binding protein FbpC OS=Pasteurella multocida (strain Pm70) GN=fbpC PE=3 SV=1 543 710 2.0E-07
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 540 701 2.0E-07
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 531 723 2.0E-07
sp|Q48PN3|METN2_PSE14 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metN2 PE=3 SV=1 542 719 2.0E-07
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 524 784 2.0E-07
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 542 723 2.0E-07
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 495 766 2.0E-07
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 527 721 2.0E-07
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 544 723 2.0E-07
sp|Q0I3Y9|POTA_HAES1 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus somnus (strain 129Pt) GN=potA PE=3 SV=1 547 719 2.0E-07
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 548 700 2.0E-07
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 548 700 2.0E-07
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 496 700 2.0E-07
sp|Q9CP06|POTA_PASMU Spermidine/putrescine import ATP-binding protein PotA OS=Pasteurella multocida (strain Pm70) GN=potA PE=3 SV=2 543 719 2.0E-07
sp|P45171|POTA_HAEIN Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potA PE=3 SV=2 543 719 2.0E-07
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 535 717 2.0E-07
sp|Q6CYU2|SSUB_PECAS Aliphatic sulfonates import ATP-binding protein SsuB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ssuB PE=3 SV=1 543 770 2.0E-07
sp|Q2W4W1|ZNUC_MAGSA Zinc import ATP-binding protein ZnuC OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=znuC PE=3 SV=1 524 739 2.0E-07
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 453 706 2.0E-07
sp|Q6NJ07|METN_CORDI Methionine import ATP-binding protein MetN OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metN PE=3 SV=1 548 719 2.0E-07
sp|Q0SK28|SSUB1_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Rhodococcus jostii (strain RHA1) GN=ssuB1 PE=3 SV=1 547 698 2.0E-07
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 547 721 2.0E-07
sp|Q39GW5|SSUB1_BURL3 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ssuB1 PE=3 SV=1 543 698 2.0E-07
sp|P23596|PRTD_DICCH Proteases secretion ATP-binding protein PrtD OS=Dickeya chrysanthemi GN=prtD PE=3 SV=1 531 763 2.0E-07
sp|Q0I2Z4|FBPC_HAES1 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1 543 710 2.0E-07
sp|Q6FAN3|METN1_ACIAD Methionine import ATP-binding protein MetN 1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN1 PE=3 SV=1 548 719 2.0E-07
sp|Q035B2|ECFA1_LACC3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus casei (strain ATCC 334) GN=ecfA1 PE=1 SV=1 527 719 2.0E-07
sp|Q93DA2|METN_STRMU Methionine import ATP-binding protein MetN OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=metN PE=3 SV=1 546 726 2.0E-07
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 547 723 2.0E-07
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 543 700 2.0E-07
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 487 733 3.0E-07
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 452 721 3.0E-07
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 498 706 3.0E-07
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 513 768 3.0E-07
sp|Q6LR20|POTA_PHOPR Spermidine/putrescine import ATP-binding protein PotA OS=Photobacterium profundum GN=potA PE=3 SV=1 544 815 3.0E-07
sp|Q4QK57|POTA_HAEI8 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain 86-028NP) GN=potA PE=3 SV=2 543 719 3.0E-07
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 512 723 3.0E-07
sp|Q6D5H7|METN1_PECAS Methionine import ATP-binding protein MetN 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN1 PE=3 SV=1 527 726 3.0E-07
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 547 724 3.0E-07
sp|Q0BMC9|METN_FRATO Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=metN PE=3 SV=1 547 719 3.0E-07
sp|Q2A3Z2|METN_FRATH Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain LVS) GN=metN PE=3 SV=1 547 719 3.0E-07
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 558 738 3.0E-07
sp|Q6GJL2|METN1_STAAR Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MRSA252) GN=metN1 PE=3 SV=1 548 719 3.0E-07
sp|P33982|Y3926_AZOC5 Probable ABC transporter ATP-binding protein AZC_3926 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=AZC_3926 PE=3 SV=1 530 724 3.0E-07
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 548 700 3.0E-07
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 497 738 3.0E-07
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 521 737 3.0E-07
sp|P0CE68|NFT1_YEAST ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFT1 PE=3 SV=1 595 724 3.0E-07
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 534 717 3.0E-07
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 540 708 3.0E-07
sp|Q5LR15|CCMA_RUEPO Cytochrome c biogenesis ATP-binding export protein CcmA OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ccmA PE=3 SV=1 542 709 3.0E-07
sp|Q04DA7|METN2_OENOB Methionine import ATP-binding protein MetN 2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=metN2 PE=3 SV=1 542 719 3.0E-07
sp|Q5HIL5|METN1_STAAC Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain COL) GN=metN1 PE=3 SV=1 548 719 3.0E-07
sp|Q2G0V2|METN1_STAA8 Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=metN1 PE=3 SV=1 548 719 3.0E-07
sp|Q2FJI0|METN1_STAA3 Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain USA300) GN=metN1 PE=3 SV=1 548 719 3.0E-07
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 521 723 3.0E-07
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 542 741 3.0E-07
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 546 728 3.0E-07
sp|O85818|POTA_AGGAC Spermidine/putrescine import ATP-binding protein PotA OS=Aggregatibacter actinomycetemcomitans GN=potA PE=3 SV=1 543 719 3.0E-07
sp|Q58663|LIVG_METJA Probable branched-chain amino acid transport ATP-binding protein LivG OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=livG PE=1 SV=1 548 739 3.0E-07
sp|Q0BFQ0|SSUB_BURCM Aliphatic sulfonates import ATP-binding protein SsuB OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ssuB PE=3 SV=1 543 698 3.0E-07
sp|Q217B2|HMUV_RHOPB Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain BisB18) GN=hmuV PE=3 SV=1 543 718 3.0E-07
sp|Q2YVT7|METN1_STAAB Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=metN1 PE=3 SV=1 548 719 3.0E-07
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 547 723 3.0E-07
sp|Q50294|ECFA1_MYCPN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ecfA1 PE=3 SV=1 547 694 3.0E-07
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 512 709 3.0E-07
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 541 708 3.0E-07
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 511 738 4.0E-07
sp|P63400|Y2353_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb2353c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2353c PE=3 SV=1 518 696 4.0E-07
sp|P9WQI7|Y2326_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv2326c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2326c PE=1 SV=1 518 696 4.0E-07
sp|P9WQI6|Y2326_MYCTO Uncharacterized ABC transporter ATP-binding protein MT2388 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2388 PE=3 SV=1 518 696 4.0E-07
sp|Q4JTG9|METN_CORJK Methionine import ATP-binding protein MetN OS=Corynebacterium jeikeium (strain K411) GN=metN PE=3 SV=1 539 719 4.0E-07
sp|Q4ZTG9|SSUB1_PSEU2 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuB1 PE=3 SV=1 543 698 4.0E-07
sp|Q895C4|METN_CLOTE Methionine import ATP-binding protein MetN OS=Clostridium tetani (strain Massachusetts / E88) GN=metN PE=3 SV=1 543 726 4.0E-07
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 546 733 4.0E-07
sp|Q0RKH4|SSUB2_FRAAA Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Frankia alni (strain ACN14a) GN=ssuB2 PE=3 SV=1 543 698 4.0E-07
sp|Q8ELA5|METN4_OCEIH Methionine import ATP-binding protein MetN 4 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN4 PE=3 SV=1 542 738 4.0E-07
sp|Q72FW5|POTA_DESVH Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=potA PE=3 SV=1 548 753 4.0E-07
sp|Q8FKF5|TAUB_ECOL6 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tauB PE=3 SV=1 543 734 4.0E-07
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 544 723 4.0E-07
sp|Q32EY4|POTA_SHIDS Spermidine/putrescine import ATP-binding protein PotA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=potA PE=3 SV=1 544 719 4.0E-07
sp|P0A9S0|FTSE_SHIFL Cell division ATP-binding protein FtsE OS=Shigella flexneri GN=ftsE PE=3 SV=1 527 733 4.0E-07
sp|P0A9R7|FTSE_ECOLI Cell division ATP-binding protein FtsE OS=Escherichia coli (strain K12) GN=ftsE PE=1 SV=1 527 733 4.0E-07
sp|P0A9R8|FTSE_ECOL6 Cell division ATP-binding protein FtsE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ftsE PE=3 SV=1 527 733 4.0E-07
sp|P0A9R9|FTSE_ECO57 Cell division ATP-binding protein FtsE OS=Escherichia coli O157:H7 GN=ftsE PE=3 SV=1 527 733 4.0E-07
sp|Q73P93|Y906_TREDE Putative ABC transporter ATP-binding protein TDE_0906 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_0906 PE=3 SV=1 548 721 4.0E-07
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 544 694 4.0E-07
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 548 700 4.0E-07
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 595 724 4.0E-07
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 595 724 4.0E-07
sp|O86751|FBPC_STRCO Fe(3+) ions import ATP-binding protein FbpC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fbpC PE=3 SV=1 543 691 4.0E-07
sp|A1B9K8|ZNUC_PARDP Zinc import ATP-binding protein ZnuC OS=Paracoccus denitrificans (strain Pd 1222) GN=znuC PE=3 SV=1 542 696 4.0E-07
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 595 724 4.0E-07
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 485 723 4.0E-07
sp|Q98QH5|ECFA1_MYCPU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ecfA1 PE=3 SV=1 548 719 4.0E-07
sp|Q9A502|METN_CAUCR Methionine import ATP-binding protein MetN OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metN PE=3 SV=1 540 719 4.0E-07
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 543 719 4.0E-07
sp|Q52666|BZTD_RHOCB Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=bztD PE=3 SV=2 543 719 4.0E-07
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 543 719 4.0E-07
sp|Q4AA75|ECFA1_MYCHJ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=ecfA1 PE=3 SV=1 547 719 4.0E-07
sp|P44531|FBPC1_HAEIN Fe(3+) ions import ATP-binding protein FbpC 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fbpC1 PE=3 SV=1 543 710 5.0E-07
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 548 704 5.0E-07
sp|Q7A470|ECFA1_STAAN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain N315) GN=ecfA1 PE=3 SV=1 548 719 5.0E-07
sp|Q99S47|ECFA1_STAAM Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ecfA1 PE=3 SV=1 548 719 5.0E-07
sp|Q5HDY6|ECFA1_STAAC Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain COL) GN=ecfA1 PE=3 SV=1 548 719 5.0E-07
sp|Q2YYM4|ECFA1_STAAB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ecfA1 PE=3 SV=2 548 719 5.0E-07
sp|Q2FW34|ECFA1_STAA8 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain NCTC 8325) GN=ecfA1 PE=3 SV=1 548 719 5.0E-07
sp|Q2FER7|ECFA1_STAA3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain USA300) GN=ecfA1 PE=3 SV=1 548 719 5.0E-07
sp|Q89UD2|CYSA_BRADU Sulfate/thiosulfate import ATP-binding protein CysA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cysA PE=3 SV=1 548 700 5.0E-07
sp|Q254K9|METN_CHLFF Methionine import ATP-binding protein MetN OS=Chlamydophila felis (strain Fe/C-56) GN=metN PE=3 SV=1 543 738 5.0E-07
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 548 738 5.0E-07
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 477 723 5.0E-07
sp|Q5X2Z8|LOLD_LEGPA Lipoprotein-releasing system ATP-binding protein LolD OS=Legionella pneumophila (strain Paris) GN=lolD PE=3 SV=1 546 719 5.0E-07
sp|Q07LQ4|SSUB_RHOP5 Aliphatic sulfonates import ATP-binding protein SsuB OS=Rhodopseudomonas palustris (strain BisA53) GN=ssuB PE=3 SV=1 543 719 5.0E-07
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 517 754 5.0E-07
sp|Q1RD28|POTA_ECOUT Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli (strain UTI89 / UPEC) GN=potA PE=3 SV=1 544 719 5.0E-07
sp|A1AA20|POTA_ECOK1 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O1:K1 / APEC GN=potA PE=3 SV=1 544 719 5.0E-07
sp|Q7NAQ6|ECFA1_MYCGA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=ecfA1 PE=3 SV=1 527 741 5.0E-07
sp|Q8X5I6|TAUB_ECO57 Taurine import ATP-binding protein TauB OS=Escherichia coli O157:H7 GN=tauB PE=3 SV=1 543 734 5.0E-07
sp|Q0T5R2|POTA_SHIF8 Spermidine/putrescine import ATP-binding protein PotA OS=Shigella flexneri serotype 5b (strain 8401) GN=potA PE=3 SV=1 544 719 5.0E-07
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 512 726 5.0E-07
sp|P75095|Y018_MYCPN Putative ABC transporter ATP-binding protein MG014 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_018 PE=3 SV=1 535 701 5.0E-07
sp|Q14H97|METN_FRAT1 Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=metN PE=3 SV=2 547 719 5.0E-07
sp|Q5NFU5|METN_FRATT Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=metN PE=3 SV=2 547 719 5.0E-07
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 527 726 6.0E-07
sp|Q04F14|METN1_OENOB Methionine import ATP-binding protein MetN 1 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=metN1 PE=3 SV=1 548 732 6.0E-07
sp|Q818I7|PSTB_BACCR Phosphate import ATP-binding protein PstB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pstB PE=3 SV=1 538 717 6.0E-07
sp|Q6MMH0|PSTB_BDEBA Phosphate import ATP-binding protein PstB OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=pstB PE=3 SV=1 539 738 6.0E-07
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 547 724 6.0E-07
sp|Q6F9A8|CYSA_ACIAD Sulfate/thiosulfate import ATP-binding protein CysA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysA PE=3 SV=1 543 700 6.0E-07
sp|P69877|POTA_SHIFL Spermidine/putrescine import ATP-binding protein PotA OS=Shigella flexneri GN=potA PE=3 SV=1 544 719 6.0E-07
sp|P69874|POTA_ECOLI Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli (strain K12) GN=potA PE=1 SV=1 544 719 6.0E-07
sp|P69875|POTA_ECOL6 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=potA PE=3 SV=1 544 719 6.0E-07
sp|Q0TIU8|POTA_ECOL5 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=potA PE=3 SV=1 544 719 6.0E-07
sp|P69876|POTA_ECO57 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O157:H7 GN=potA PE=3 SV=1 544 719 6.0E-07
sp|Q8FV85|METN_BRUSU Methionine import ATP-binding protein MetN OS=Brucella suis biovar 1 (strain 1330) GN=metN PE=3 SV=2 548 719 6.0E-07
sp|Q8YD40|METN_BRUME Methionine import ATP-binding protein MetN OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=metN PE=3 SV=1 548 719 6.0E-07
sp|Q579H8|METN_BRUAB Methionine import ATP-binding protein MetN OS=Brucella abortus biovar 1 (strain 9-941) GN=metN PE=3 SV=2 548 719 6.0E-07
sp|Q2YIV5|METN_BRUA2 Methionine import ATP-binding protein MetN OS=Brucella abortus (strain 2308) GN=metN PE=3 SV=2 548 719 6.0E-07
sp|Q3Z2Z3|POTA_SHISS Spermidine/putrescine import ATP-binding protein PotA OS=Shigella sonnei (strain Ss046) GN=potA PE=3 SV=1 544 719 6.0E-07
sp|Q31ZK0|POTA_SHIBS Spermidine/putrescine import ATP-binding protein PotA OS=Shigella boydii serotype 4 (strain Sb227) GN=potA PE=3 SV=1 544 719 6.0E-07
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 524 723 6.0E-07
sp|Q6N999|LOLD1_RHOPA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lolD1 PE=3 SV=1 546 726 6.0E-07
sp|C0SP98|YKFD_BACSU Putative oligopeptide transport ATP-binding protein YkfD OS=Bacillus subtilis (strain 168) GN=ykfD PE=3 SV=1 548 727 6.0E-07
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 512 723 6.0E-07
sp|Q7VNG4|POTA_HAEDU Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=potA PE=3 SV=1 543 719 6.0E-07
sp|Q9KS33|POTA_VIBCH Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=potA PE=3 SV=1 544 719 6.0E-07
sp|Q8PM59|PSTB_XANAC Phosphate import ATP-binding protein PstB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pstB PE=3 SV=1 548 758 6.0E-07
sp|Q2YJJ8|Y1053_BRUA2 Putative peptide import ATP-binding protein BAB2_1053 OS=Brucella abortus (strain 2308) GN=BAB2_1053 PE=3 SV=1 538 710 6.0E-07
sp|Q8VQK7|Y1034_BRUAB Putative peptide import ATP-binding protein BruAb2_1034 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_1034 PE=3 SV=1 538 710 6.0E-07
sp|Q6KHL1|ECFA1_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1 540 719 6.0E-07
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 487 706 7.0E-07
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 547 709 7.0E-07
sp|Q3BV68|PSTB_XANC5 Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pstB PE=3 SV=2 548 758 7.0E-07
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 540 723 7.0E-07
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 540 723 7.0E-07
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 540 723 7.0E-07
sp|Q31I51|ZNUC_THICR Zinc import ATP-binding protein ZnuC OS=Thiomicrospira crunogena (strain XCL-2) GN=znuC PE=3 SV=1 543 710 7.0E-07
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 545 723 7.0E-07
sp|Q46ZU5|SSUB_CUPPJ Aliphatic sulfonates import ATP-binding protein SsuB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ssuB PE=3 SV=1 544 719 7.0E-07
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 548 725 7.0E-07
sp|Q0P9X7|PEB1C_CAMJE Probable ABC transporter ATP-binding protein PEB1C OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=peb1C PE=3 SV=1 543 726 7.0E-07
sp|Q1RFH8|TAUB_ECOUT Taurine import ATP-binding protein TauB OS=Escherichia coli (strain UTI89 / UPEC) GN=tauB PE=3 SV=1 543 734 7.0E-07
sp|Q0TKS1|TAUB_ECOL5 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tauB PE=3 SV=1 543 734 7.0E-07
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 540 723 7.0E-07
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 469 708 7.0E-07
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 544 724 8.0E-07
sp|Q8NVB5|ECFA1_STAAW Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MW2) GN=ecfA1 PE=3 SV=1 548 719 8.0E-07
sp|Q6G799|ECFA1_STAAS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MSSA476) GN=ecfA1 PE=3 SV=1 548 719 8.0E-07
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 527 756 8.0E-07
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 547 782 8.0E-07
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 527 716 8.0E-07
sp|Q32IZ6|TAUB_SHIDS Taurine import ATP-binding protein TauB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tauB PE=3 SV=1 543 734 8.0E-07
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 548 719 8.0E-07
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 540 700 8.0E-07
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 543 719 9.0E-07
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 548 719 9.0E-07
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 463 723 9.0E-07
sp|Q8RCU0|PSTB1_CALS4 Phosphate import ATP-binding protein PstB 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB1 PE=3 SV=1 563 764 9.0E-07
sp|Q63E84|POTA_BACCZ Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ZK / E33L) GN=potA PE=3 SV=2 543 753 9.0E-07
sp|Q73BM0|POTA_BACC1 Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=potA PE=3 SV=1 543 753 9.0E-07
sp|A0RBB0|POTA_BACAH Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus thuringiensis (strain Al Hakam) GN=potA PE=3 SV=1 543 753 9.0E-07
sp|Q6HLQ9|POTA_BACHK Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=potA PE=3 SV=2 543 753 9.0E-07
sp|Q5LUR8|ZNUC_RUEPO Zinc import ATP-binding protein ZnuC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=znuC PE=3 SV=1 544 710 9.0E-07
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 540 723 9.0E-07
sp|Q88WA5|METN1_LACPL Methionine import ATP-binding protein MetN 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metN1 PE=3 SV=1 548 747 1.0E-06
sp|Q8PAG0|PSTB_XANCP Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pstB PE=3 SV=1 565 758 1.0E-06
sp|Q4UT63|PSTB_XANC8 Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pstB PE=3 SV=1 565 758 1.0E-06
sp|Q20ZS6|LOLD2_RHOPB Lipoprotein-releasing system ATP-binding protein LolD 2 OS=Rhodopseudomonas palustris (strain BisB18) GN=lolD2 PE=3 SV=1 546 726 1.0E-06
sp|Q92AF9|MNTB_LISIN Manganese transport system ATP-binding protein MntB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mntB PE=3 SV=1 548 718 1.0E-06
sp|Q63SP4|LOLD_BURPS Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia pseudomallei (strain K96243) GN=lolD PE=3 SV=2 540 717 1.0E-06
sp|Q62J04|LOLD_BURMA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia mallei (strain ATCC 23344) GN=lolD PE=3 SV=2 540 717 1.0E-06
sp|P0AAI0|SAPF_SHIFL Peptide transport system ATP-binding protein SapF OS=Shigella flexneri GN=sapF PE=3 SV=1 546 727 1.0E-06
sp|P0AAH8|SAPF_ECOLI Peptide transport system ATP-binding protein SapF OS=Escherichia coli (strain K12) GN=sapF PE=1 SV=1 546 727 1.0E-06
sp|P0AAH9|SAPF_ECOL6 Peptide transport system ATP-binding protein SapF OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sapF PE=3 SV=1 546 727 1.0E-06
sp|Q1GIE5|POTA_RUEST Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria sp. (strain TM1040) GN=potA PE=3 SV=1 539 719 1.0E-06
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 514 723 1.0E-06
sp|Q0I4A9|ZNUC_HAES1 Zinc import ATP-binding protein ZnuC OS=Haemophilus somnus (strain 129Pt) GN=znuC PE=3 SV=1 547 710 1.0E-06
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 548 700 1.0E-06
sp|Q1GL85|ZNUC_RUEST Zinc import ATP-binding protein ZnuC OS=Ruegeria sp. (strain TM1040) GN=znuC PE=3 SV=1 544 706 1.0E-06
sp|Q87RS1|METN_VIBPA Methionine import ATP-binding protein MetN OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metN PE=1 SV=1 539 726 1.0E-06
sp|P96117|TROB_TREPA Zinc transport system ATP-binding protein TroB OS=Treponema pallidum (strain Nichols) GN=troB PE=3 SV=1 563 718 1.0E-06
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 513 723 1.0E-06
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 510 701 1.0E-06
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 543 710 1.0E-06
sp|Q03AH0|POTA_LACC3 Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus casei (strain ATCC 334) GN=potA PE=3 SV=1 543 719 1.0E-06
sp|Q87C88|PSTB_XYLFT Phosphate import ATP-binding protein PstB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pstB PE=3 SV=1 565 758 1.0E-06
sp|Q2SRI1|ECFA1_MYCCT Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=ecfA1 PE=3 SV=1 548 740 1.0E-06
sp|Q18CJ0|ECFA1_PEPD6 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Peptoclostridium difficile (strain 630) GN=ecfA1 PE=3 SV=1 548 719 1.0E-06
sp|Q7MMN0|ZNUC_VIBVY Zinc import ATP-binding protein ZnuC OS=Vibrio vulnificus (strain YJ016) GN=znuC PE=3 SV=1 545 702 1.0E-06
sp|Q8DFQ4|ZNUC_VIBVU Zinc import ATP-binding protein ZnuC OS=Vibrio vulnificus (strain CMCP6) GN=znuC PE=3 SV=1 545 702 1.0E-06
sp|Q3Z542|TAUB_SHISS Taurine import ATP-binding protein TauB OS=Shigella sonnei (strain Ss046) GN=tauB PE=3 SV=1 543 734 1.0E-06
sp|Q47538|TAUB_ECOLI Taurine import ATP-binding protein TauB OS=Escherichia coli (strain K12) GN=tauB PE=2 SV=1 543 734 1.0E-06
sp|Q1B8U4|SSUB_MYCSS Aliphatic sulfonates import ATP-binding protein SsuB OS=Mycobacterium sp. (strain MCS) GN=ssuB PE=3 SV=1 543 698 1.0E-06
sp|Q325N3|TAUB_SHIBS Taurine import ATP-binding protein TauB OS=Shigella boydii serotype 4 (strain Sb227) GN=tauB PE=3 SV=1 543 734 1.0E-06
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 546 740 1.0E-06
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 548 719 1.0E-06
sp|Q8YDH1|Y205_BRUME Putative peptide import ATP-binding protein BMEII0205 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=BMEII0205 PE=3 SV=1 538 710 1.0E-06
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 513 723 2.0E-06
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 527 723 2.0E-06
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 547 755 2.0E-06
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 467 723 2.0E-06
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 546 723 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0140359 ABC-type transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0051234 establishment of localization No
GO:0140657 ATP-dependent activity No
GO:0051179 localization No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0022804 active transmembrane transporter activity No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0006810 transport No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0031224 intrinsic component of membrane No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0000166 nucleotide binding No
GO:0005215 transporter activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.5

Transmembrane Domains

Domain # Start End Length
1 38 57 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4494
MPVQSTLRRTAAEDALAAFLDKWNTLVRARLRRTSRTARALATLALALSIVLGAEGTRRRWKRQRLEREQGRKLV
RTNSWLHNKDGSRTIYVPYKQSTSKITINTTSPLTFEAHRRLFLNPPRVSGLGYGTVPAAHTKPGLNLAFLHQFL
SLMSIMLPRWSSKEAGLLLSHGVFLMLRTYLSLVVARLDGELVRDLVAGNGKAFLWGILKWCGLGGFASYTNAMI
KFLESKVSIAFRTRLTRYIHDLYLNDHLTFYKLANLDGGVGQGADQFITQDLTLFCAASANLYSSLGKPFVDLCV
FSFQLYRSLGPLALSGILSNYFLTASILRRLSPPFGKLKAVEGRKEGDFRSLHARLIANAEEVAFYGGADMEKTF
LNKEYKSLKSWMEGIYMLKIRYNIIEDFILKYSWSAYGYLLASLPVFLPAWGGVGGAAEMTEGTEKGGRERNRMK
DFITNKRLMLSLADAGGRMMYSIKDLAELAGYTSRVYTLISTLHRVHADAYHVRGGQNEIYSLSDVQGTIQKGFD
GVRFEHVPVVAPGLWPQGGEELLDSLSMIVRRGEHLLISGPNGVGKSAISRVLAGLWPVYRGLVSRPKSIGEDGI
MFLPQRPYLSPGTLRDQVIYPDGHVDMREKRKSEDDLKRVLELAKLGYLPDREGGWDTRKEWKDVLSGGEKQRMA
FARLLYHEPQYAVIDEGTSAVSSDVEGLLYETCKERGITLITISTRASLKKYHTFNLILGMGDHGDGWEFERIGT
EREKLQVEKELQELRERLLQVEGWKNRRDEIEQELAAVWMDKGEPLTQPDAMEVVEKTQDEEPEGASQ*
Coding >Ophun1|4494
ATGCCAGTCCAGTCCACGCTGCGAAGGACGGCGGCCGAAGACGCGCTGGCAGCTTTCCTCGACAAATGGAACACG
CTTGTCCGCGCCAGGCTGCGCAGAACCTCGCGGACCGCCCGCGCGCTGGCCACGCTCGCCCTTGCGCTGTCCATC
GTCCTCGGCGCCGAGGGAACCCGACGTCGGTGGAAGAGGCAACGCCTTGAGCGAGAGCAGGGCCGGAAGCTCGTC
CGCACAAACTCGTGGCTGCACAACAAGGATGGGTCGCGTACCATTTACGTCCCCTACAAGCAGAGCACCTCAAAG
ATCACCATCAATACCACCAGTCCTCTCACCTTCGAGGCGCACCGACGACTCTTCCTCAATCCTCCTCGCGTCTCC
GGCCTGGGCTATGGGACGGTCCCCGCGGCGCATACGAAACCGGGCTTGAACCTCGCCTTTCTACACCAGTTCCTC
AGTCTGATGAGCATCATGCTCCCTCGATGGTCGAGCAAAGAGGCCGGCCTGCTACTCAGCCATGGAGTATTCCTC
ATGCTCAGGACCTATCTCTCCTTGGTGGTAGCCCGCTTGGATGGCGAGCTGGTGAGGGATCTCGTCGCCGGCAAC
GGCAAGGCATTCCTCTGGGGCATCCTCAAGTGGTGCGGCTTGGGAGGATTCGCTTCCTACACCAACGCAATGATC
AAGTTCCTGGAATCCAAAGTGTCCATCGCCTTCAGGACGCGCCTCACGAGGTATATTCACGACCTGTATCTGAAC
GATCACCTCACCTTTTATAAATTAGCCAATCTCGATGGTGGTGTCGGTCAAGGGGCGGACCAGTTCATCACGCAG
GACTTGACCCTGTTCTGTGCCGCCTCTGCCAACCTGTACTCGTCGCTAGGCAAACCCTTCGTCGACCTCTGCGTC
TTTAGCTTTCAACTATACCGCTCTCTAGGGCCCCTGGCCCTCTCGGGTATCTTGAGCAACTACTTCCTGACTGCC
AGCATCCTGCGCCGTCTCTCACCGCCGTTCGGAAAACTCAAGGCTGTCGAAGGACGCAAGGAGGGCGACTTCCGA
AGCCTCCACGCTCGACTGATTGCCAATGCCGAAGAAGTCGCCTTCTACGGCGGCGCAGACATGGAGAAGACGTTC
CTAAACAAGGAATACAAGTCGCTGAAGAGCTGGATGGAGGGCATCTACATGCTCAAGATCCGGTATAATATCATC
GAGGACTTTATCCTCAAGTACAGCTGGAGCGCATACGGCTACCTTCTCGCCTCTCTACCCGTTTTCCTGCCTGCC
TGGGGCGGCGTCGGCGGTGCGGCGGAGATGACCGAAGGCACAGAAAAGGGCGGCCGCGAGCGGAACCGGATGAAG
GACTTCATCACCAACAAGAGGCTGATGCTGTCCCTGGCAGACGCTGGCGGTCGCATGATGTACTCGATCAAGGAC
TTGGCTGAGCTGGCGGGTTACACCAGCCGAGTCTACACGCTGATCTCGACCTTGCACCGGGTTCATGCCGACGCC
TATCACGTTCGCGGCGGGCAGAACGAGATTTACTCGCTTTCGGATGTGCAGGGCACCATACAGAAAGGCTTCGAC
GGCGTACGATTCGAGCACGTCCCAGTAGTGGCGCCAGGGCTGTGGCCGCAAGGGGGCGAGGAGCTACTGGACTCG
CTGTCCATGATTGTTCGGAGAGGAGAGCATCTCTTGATCTCCGGGCCCAATGGGGTTGGGAAAAGCGCCATCAGT
CGAGTTCTTGCCGGACTGTGGCCTGTCTATCGCGGTCTCGTCAGCCGACCGAAGAGCATCGGAGAGGACGGCATC
ATGTTCCTGCCGCAGAGGCCGTATCTCAGTCCCGGCACGCTTCGTGATCAGGTCATCTACCCCGATGGCCATGTG
GACATGCGGGAGAAGCGCAAGTCGGAAGACGATCTGAAGAGGGTCCTCGAGCTAGCCAAGCTCGGCTACCTCCCG
GACCGAGAGGGCGGCTGGGACACTCGCAAGGAATGGAAGGATGTTCTCAGCGGCGGCGAGAAGCAGAGGATGGCG
TTTGCGCGGCTGCTCTATCATGAGCCGCAATACGCCGTCATTGACGAAGGCACGAGCGCCGTGTCGAGCGATGTC
GAGGGCCTCTTGTACGAGACGTGCAAGGAAAGGGGCATCACACTCATCACCATCTCGACGCGCGCATCGCTCAAA
AAGTACCACACCTTCAACCTCATCCTCGGAATGGGCGATCACGGCGACGGATGGGAGTTTGAGCGGATCGGGACG
GAGCGGGAGAAGCTGCAGGTGGAAAAGGAGCTACAGGAACTGCGCGAGCGTCTTCTTCAAGTGGAGGGTTGGAAG
AACAGACGGGATGAGATTGAGCAGGAACTGGCAGCCGTCTGGATGGACAAGGGGGAGCCCCTGACGCAGCCGGAT
GCGATGGAGGTGGTCGAGAAGACGCAAGATGAGGAACCGGAGGGGGCCAGTCAGTGA
Transcript >Ophun1|4494
ATGCCAGTCCAGTCCACGCTGCGAAGGACGGCGGCCGAAGACGCGCTGGCAGCTTTCCTCGACAAATGGAACACG
CTTGTCCGCGCCAGGCTGCGCAGAACCTCGCGGACCGCCCGCGCGCTGGCCACGCTCGCCCTTGCGCTGTCCATC
GTCCTCGGCGCCGAGGGAACCCGACGTCGGTGGAAGAGGCAACGCCTTGAGCGAGAGCAGGGCCGGAAGCTCGTC
CGCACAAACTCGTGGCTGCACAACAAGGATGGGTCGCGTACCATTTACGTCCCCTACAAGCAGAGCACCTCAAAG
ATCACCATCAATACCACCAGTCCTCTCACCTTCGAGGCGCACCGACGACTCTTCCTCAATCCTCCTCGCGTCTCC
GGCCTGGGCTATGGGACGGTCCCCGCGGCGCATACGAAACCGGGCTTGAACCTCGCCTTTCTACACCAGTTCCTC
AGTCTGATGAGCATCATGCTCCCTCGATGGTCGAGCAAAGAGGCCGGCCTGCTACTCAGCCATGGAGTATTCCTC
ATGCTCAGGACCTATCTCTCCTTGGTGGTAGCCCGCTTGGATGGCGAGCTGGTGAGGGATCTCGTCGCCGGCAAC
GGCAAGGCATTCCTCTGGGGCATCCTCAAGTGGTGCGGCTTGGGAGGATTCGCTTCCTACACCAACGCAATGATC
AAGTTCCTGGAATCCAAAGTGTCCATCGCCTTCAGGACGCGCCTCACGAGGTATATTCACGACCTGTATCTGAAC
GATCACCTCACCTTTTATAAATTAGCCAATCTCGATGGTGGTGTCGGTCAAGGGGCGGACCAGTTCATCACGCAG
GACTTGACCCTGTTCTGTGCCGCCTCTGCCAACCTGTACTCGTCGCTAGGCAAACCCTTCGTCGACCTCTGCGTC
TTTAGCTTTCAACTATACCGCTCTCTAGGGCCCCTGGCCCTCTCGGGTATCTTGAGCAACTACTTCCTGACTGCC
AGCATCCTGCGCCGTCTCTCACCGCCGTTCGGAAAACTCAAGGCTGTCGAAGGACGCAAGGAGGGCGACTTCCGA
AGCCTCCACGCTCGACTGATTGCCAATGCCGAAGAAGTCGCCTTCTACGGCGGCGCAGACATGGAGAAGACGTTC
CTAAACAAGGAATACAAGTCGCTGAAGAGCTGGATGGAGGGCATCTACATGCTCAAGATCCGGTATAATATCATC
GAGGACTTTATCCTCAAGTACAGCTGGAGCGCATACGGCTACCTTCTCGCCTCTCTACCCGTTTTCCTGCCTGCC
TGGGGCGGCGTCGGCGGTGCGGCGGAGATGACCGAAGGCACAGAAAAGGGCGGCCGCGAGCGGAACCGGATGAAG
GACTTCATCACCAACAAGAGGCTGATGCTGTCCCTGGCAGACGCTGGCGGTCGCATGATGTACTCGATCAAGGAC
TTGGCTGAGCTGGCGGGTTACACCAGCCGAGTCTACACGCTGATCTCGACCTTGCACCGGGTTCATGCCGACGCC
TATCACGTTCGCGGCGGGCAGAACGAGATTTACTCGCTTTCGGATGTGCAGGGCACCATACAGAAAGGCTTCGAC
GGCGTACGATTCGAGCACGTCCCAGTAGTGGCGCCAGGGCTGTGGCCGCAAGGGGGCGAGGAGCTACTGGACTCG
CTGTCCATGATTGTTCGGAGAGGAGAGCATCTCTTGATCTCCGGGCCCAATGGGGTTGGGAAAAGCGCCATCAGT
CGAGTTCTTGCCGGACTGTGGCCTGTCTATCGCGGTCTCGTCAGCCGACCGAAGAGCATCGGAGAGGACGGCATC
ATGTTCCTGCCGCAGAGGCCGTATCTCAGTCCCGGCACGCTTCGTGATCAGGTCATCTACCCCGATGGCCATGTG
GACATGCGGGAGAAGCGCAAGTCGGAAGACGATCTGAAGAGGGTCCTCGAGCTAGCCAAGCTCGGCTACCTCCCG
GACCGAGAGGGCGGCTGGGACACTCGCAAGGAATGGAAGGATGTTCTCAGCGGCGGCGAGAAGCAGAGGATGGCG
TTTGCGCGGCTGCTCTATCATGAGCCGCAATACGCCGTCATTGACGAAGGCACGAGCGCCGTGTCGAGCGATGTC
GAGGGCCTCTTGTACGAGACGTGCAAGGAAAGGGGCATCACACTCATCACCATCTCGACGCGCGCATCGCTCAAA
AAGTACCACACCTTCAACCTCATCCTCGGAATGGGCGATCACGGCGACGGATGGGAGTTTGAGCGGATCGGGACG
GAGCGGGAGAAGCTGCAGGTGGAAAAGGAGCTACAGGAACTGCGCGAGCGTCTTCTTCAAGTGGAGGGTTGGAAG
AACAGACGGGATGAGATTGAGCAGGAACTGGCAGCCGTCTGGATGGACAAGGGGGAGCCCCTGACGCAGCCGGAT
GCGATGGAGGTGGTCGAGAAGACGCAAGATGAGGAACCGGAGGGGGCCAGTCAGTGA
Gene >Ophun1|4494
ATGCCAGTCCAGTCCACGCTGCGAAGGACGGCGGCCGAAGACGCGCTGGCAGCTTTCCTCGACAAATGGAACACG
CTTGTCCGCGCCAGGCTGCGCAGAACCTCGCGGACCGCCCGCGCGCTGGCCACGCTCGCCCTTGCGCTGTCCATC
GTCCTCGGCGCCGAGGGAACCCGACGTCGGTGGAAGAGGCAACGCCTTGAGCGAGAGCAGGGCCGGAAGCTCGTC
CGCACAAACTCGTGGCTGCACAACAAGGATGGGTCGCGTACCATTTACGTCCCCTACAAGCAGAGCACCTCAAAG
ATCACCATCAATACCACCAGTCCTCTCACCTTCGAGGCGCACCGACGACTCTTCCTCAATCCTCCTCGCGTCTCC
GGCCTGGGCTATGGGACGGTCCCCGCGGCGCATACGAAACCGGGCTTGAACCTCGCCTTTCTACACCAGTTCCTC
AGTCTGATGAGCATCATGCTCCCTCGATGGTCGAGCAAAGAGGCCGGCCTGCTACTCAGCCATGGAGTATTCCTC
ATGCTCAGGACCTATCTCTCCTTGGTGGTAGCCCGCTTGGATGGCGAGCTGGTGAGGGATCTCGTCGCCGGCAAC
GGCAAGGCATTCCTCTGGGGCATCCTCAAGGTACCTTTGCTTCCTTTGTCGGCGAGTCCCTGTCGAAGTGGCAGG
GCTTCCCGTGCGCTAATAACCATGACCTGGGCAGTGGTGCGGCTTGGGAGGATTCGCTTCCTACACCAACGCAAT
GATCAAGTTCCTGGAATCCAAAGTGTCCATCGCCTTCAGGACGCGCCTCACGAGGTATATTCACGACCTGTATCT
GAACGATCACCTCACCTTTTATAAATTAGCCAATCTCGATGGTGGTGTCGGTCAAGGGGCGGACCAGTTCATCAC
GCAGGACTTGACCCTGTTCTGTGCCGCCTCTGCCAACCTGTACTCGTCGCTAGGCAAACCCTTCGTCGACCTCTG
CGTCTTTAGCTTTCAACTATACCGCTCTCTAGGGCCCCTGGCCCTCTCGGGTATCTTGAGCAACTACTTCCTGAC
TGCCAGCATCCTGCGCCGTCTCTCACCGCCGTTCGGAAAACTCAAGGCTGTCGAAGGACGCAAGGAGGGCGACTT
CCGAAGCCTCCACGCTCGACTGATTGCCAATGCCGAAGAAGTCGCCTTCTACGGCGGCGCAGACATGGAGAAGAC
GTTCCTAAACAAGGAATACAAGTCGCTGAAGAGCTGGATGGAGGGCATCTACATGCTCAAGATCCGGTATAATAT
CATCGAGGACTTTATCCTCAAGTACAGCTGGAGCGCATACGGCTACCTTCTCGCCTCTCTACCCGTTTTCCTGCC
TGCCTGGGGCGGCGTCGGCGGTGCGGCGGAGATGACCGAAGGCACAGAAAAGGGCGGCCGCGAGCGGAACCGGAT
GAAGGACTTCATCACCAACAAGAGGCTGATGCTGTCCCTGGCAGACGCTGGCGGTCGCATGATGTACTCGATCAA
GGACTTGGCTGAGCTGGCGGGTTACACCAGCCGAGTCTACACGCTGATCTCGACCTTGCACCGGGTTCATGCCGA
CGCCTATCACGTTCGCGGCGGGCAGAACGAGATTTACTCGCTTTCGGATGTGCAGGGCACCATACAGAAAGGCTT
CGACGGCGTACGATTCGAGCACGTCCCAGTAGTGGCGCCAGGGCTGTGGCCGCAAGGGGGCGAGGAGCTACTGGA
CTCGCTGTCCATGATTGTTCGGAGAGGAGAGCATCTCTTGGTAAGAGGATATACGTTCGAGTCTTTGCCCTCCCC
TGACACGTTGCTTGGCAGATCTCCGGGCCCAATGGGGTTGGGAAAAGCGCCATCAGTCGAGTTCTTGCCGGACTG
TGGCCTGTCTATCGCGGTCTCGTCAGCCGACCGAAGAGCATCGGAGAGGACGGCATCATGTTCCTGCCGCAGAGG
CCGTATCTCAGTCCCGGCACGCTTCGTGATCAGGTCATCTACCCCGATGGCCATGTGGACATGCGGGAGAAGCGC
AAGTCGGAAGACGATCTGAAGAGGGTCCTCGAGCTAGCCAAGCTCGGCTACCTCCCGGACCGAGAGGGCGGCTGG
GACACTCGCAAGGAATGGAAGGATGTTCTCAGCGGCGGCGAGAAGCAGAGGATGGCGTTTGCGCGGCTGCTCTAT
CATGAGCCGCAATACGCCGTCATTGACGAAGGCACGAGCGCCGTGTCGAGCGATGTCGAGGGCCTCTTGTACGAG
ACGTGCAAGGAAAGGGGCATCAGTGAGTGCATTCTTCGGGAGGACACAATCCAAGGCAAGACTGACAAGCTTCGC
GGGAGCAGCACTCATCACCATCTCGACGCGCGCATCGCTCAAAAAGTACCACACCTTCAACCTCATCCTCGGAAT
GGGCGATCACGGCGACGGATGGGAGTTTGAGCGGATCGGGACGGAGCGGGAGAAGCTGCAGGTGGAAAAGGAGCT
ACAGGAACTGCGCGAGCGTCTTCTTCAAGTGGAGGGTTGGAAGAACAGACGGGATGAGATTGAGCAGGAACTGGC
AGCCGTCTGGATGGACAAGGGGGAGCCCCTGACGCAGCCGGATGCGATGGAGGTGGTCGAGAAGACGCAAGATGA
GGAACCGGAGGGGGCCAGTCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail