Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4489
Gene name
LocationContig_414:15509..16234
Strand-
Gene length (bp)725
Transcript length (bp)663
Coding sequence length (bp)663
Protein length (aa) 221

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 1.4E-10 21 85

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.99976

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup977
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6629
Ophiocordyceps australis map64 (Brazil) OphauB2|3088
Ophiocordyceps australis map64 (Brazil) OphauB2|6718
Ophiocordyceps camponoti-floridani Ophcf2|00850
Ophiocordyceps camponoti-rufipedis Ophun1|4489 (this protein)
Ophiocordyceps kimflemingae Ophio5|612
Ophiocordyceps subramaniannii Hirsu2|7886

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4489
MKTTFAVVAVAGLAAAQDFAGQPQCAIGCIRDALPKVGCRVEDVACACKPETQARLLSEVAPCVIGHCSPQEAQQ
AQGAARAACAKVGSQTQSQQGGASSSQGAASGSDSSDSGSASQTSSMTVMTTTGTPVTATATATDTASDSGDDDN
STATGGDQSQSQSGSATDSGSSDQPSSTGGGSSGSSSTSSRNASPSSTGAAAGGPSTGAFAAIMALVLAL*
Coding >Ophun1|4489
ATGAAGACTACCTTTGCCGTCGTTGCTGTTGCTGGCCTTGCTGCCGCTCAGGACTTTGCTGGCCAGCCCCAATGC
GCTATCGGCTGCATCCGTGATGCTCTTCCCAAGGTCGGCTGCCGGGTCGAGGACGTGGCCTGCGCCTGCAAGCCC
GAGACTCAGGCCCGGCTCCTGAGCGAGGTGGCTCCTTGCGTCATCGGCCACTGCTCTCCGCAGGAGGCTCAGCAG
GCTCAGGGCGCTGCGAGGGCCGCCTGTGCCAAGGTCGGCTCCCAGACGCAGTCGCAGCAGGGTGGTGCCTCTTCC
TCCCAGGGCGCTGCCTCGGGCTCCGATTCCTCCGACTCGGGCTCGGCCTCGCAGACGAGCTCCATGACCGTCATG
ACGACGACGGGCACTCCCGTTACCGCCACTGCCACCGCCACCGACACGGCCTCCGACTCGGGTGATGACGACAAC
TCTACGGCCACTGGCGGCGACCAGTCCCAGTCTCAGTCCGGCAGCGCCACCGACTCCGGCTCCTCGGATCAGCCT
TCTAGCACTGGCGGCGGCTCGTCTGGATCCTCCTCGACCAGCTCCCGCAATGCCTCGCCCAGCTCGACGGGTGCC
GCGGCCGGTGGTCCTTCTACCGGCGCCTTTGCTGCCATCATGGCTCTTGTCTTGGCCTTGTAA
Transcript >Ophun1|4489
ATGAAGACTACCTTTGCCGTCGTTGCTGTTGCTGGCCTTGCTGCCGCTCAGGACTTTGCTGGCCAGCCCCAATGC
GCTATCGGCTGCATCCGTGATGCTCTTCCCAAGGTCGGCTGCCGGGTCGAGGACGTGGCCTGCGCCTGCAAGCCC
GAGACTCAGGCCCGGCTCCTGAGCGAGGTGGCTCCTTGCGTCATCGGCCACTGCTCTCCGCAGGAGGCTCAGCAG
GCTCAGGGCGCTGCGAGGGCCGCCTGTGCCAAGGTCGGCTCCCAGACGCAGTCGCAGCAGGGTGGTGCCTCTTCC
TCCCAGGGCGCTGCCTCGGGCTCCGATTCCTCCGACTCGGGCTCGGCCTCGCAGACGAGCTCCATGACCGTCATG
ACGACGACGGGCACTCCCGTTACCGCCACTGCCACCGCCACCGACACGGCCTCCGACTCGGGTGATGACGACAAC
TCTACGGCCACTGGCGGCGACCAGTCCCAGTCTCAGTCCGGCAGCGCCACCGACTCCGGCTCCTCGGATCAGCCT
TCTAGCACTGGCGGCGGCTCGTCTGGATCCTCCTCGACCAGCTCCCGCAATGCCTCGCCCAGCTCGACGGGTGCC
GCGGCCGGTGGTCCTTCTACCGGCGCCTTTGCTGCCATCATGGCTCTTGTCTTGGCCTTGTAA
Gene >Ophun1|4489
ATGAAGACTACCTTTGCCGTCGTTGCTGTTGCTGGCCTTGCTGCCGCTCAGGACTTTGCTGGCCAGCCCCAATGC
GCTGTATGGCTTTATCGCTTCCTCTATGCAGCTGGACGTGTTGACTGACATTGTTCCTCGTTCAGATCGGCTGCA
TCCGTGATGCTCTTCCCAAGGTCGGCTGCCGGGTCGAGGACGTGGCCTGCGCCTGCAAGCCCGAGACTCAGGCCC
GGCTCCTGAGCGAGGTGGCTCCTTGCGTCATCGGCCACTGCTCTCCGCAGGAGGCTCAGCAGGCTCAGGGCGCTG
CGAGGGCCGCCTGTGCCAAGGTCGGCTCCCAGACGCAGTCGCAGCAGGGTGGTGCCTCTTCCTCCCAGGGCGCTG
CCTCGGGCTCCGATTCCTCCGACTCGGGCTCGGCCTCGCAGACGAGCTCCATGACCGTCATGACGACGACGGGCA
CTCCCGTTACCGCCACTGCCACCGCCACCGACACGGCCTCCGACTCGGGTGATGACGACAACTCTACGGCCACTG
GCGGCGACCAGTCCCAGTCTCAGTCCGGCAGCGCCACCGACTCCGGCTCCTCGGATCAGCCTTCTAGCACTGGCG
GCGGCTCGTCTGGATCCTCCTCGACCAGCTCCCGCAATGCCTCGCCCAGCTCGACGGGTGCCGCGGCCGGTGGTC
CTTCTACCGGCGCCTTTGCTGCCATCATGGCTCTTGTCTTGGCCTTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail