Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4486
Gene name
LocationContig_414:9977..11400
Strand+
Gene length (bp)1423
Transcript length (bp)1326
Coding sequence length (bp)1326
Protein length (aa) 442

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05631 MFS_5 Sugar-tranasporters, 12 TM 3.6E-52 41 323
PF07690 MFS_1 Major Facilitator Superfamily 2.1E-15 82 396

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6DG19|MFSD5_DANRE Molybdate-anion transporter OS=Danio rerio GN=mfsd5 PE=2 SV=1 42 399 2.0E-32
sp|Q6N075|MFSD5_HUMAN Molybdate-anion transporter OS=Homo sapiens GN=MFSD5 PE=1 SV=2 43 413 7.0E-30
sp|Q921Y4|MFSD5_MOUSE Molybdate-anion transporter OS=Mus musculus GN=Mfsd5 PE=2 SV=1 43 416 9.0E-30
sp|Q1KKV8|MFSD5_TAKRU Molybdate-anion transporter OS=Takifugu rubripes GN=mfsd5 PE=3 SV=1 32 399 2.0E-29
sp|Q0VC03|MFSD5_BOVIN Molybdate-anion transporter OS=Bos taurus GN=MFSD5 PE=2 SV=1 43 416 1.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6DG19|MFSD5_DANRE Molybdate-anion transporter OS=Danio rerio GN=mfsd5 PE=2 SV=1 42 399 2.0E-32
sp|Q6N075|MFSD5_HUMAN Molybdate-anion transporter OS=Homo sapiens GN=MFSD5 PE=1 SV=2 43 413 7.0E-30
sp|Q921Y4|MFSD5_MOUSE Molybdate-anion transporter OS=Mus musculus GN=Mfsd5 PE=2 SV=1 43 416 9.0E-30
sp|Q1KKV8|MFSD5_TAKRU Molybdate-anion transporter OS=Takifugu rubripes GN=mfsd5 PE=3 SV=1 32 399 2.0E-29
sp|Q0VC03|MFSD5_BOVIN Molybdate-anion transporter OS=Bos taurus GN=MFSD5 PE=2 SV=1 43 416 1.0E-28
sp|Q5R542|MFSD5_PONAB Molybdate-anion transporter OS=Pongo abelii GN=MFSD5 PE=2 SV=1 43 416 2.0E-27
sp|Q08B29|MFSD5_XENLA Molybdate-anion transporter OS=Xenopus laevis GN=mfsd5 PE=2 SV=1 42 399 4.0E-26
sp|Q28E13|MFSD5_XENTR Molybdate-anion transporter OS=Xenopus tropicalis GN=mfsd5 PE=2 SV=1 25 399 2.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0015689 molybdate ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0015098 molybdate ion transmembrane transporter activity Yes
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No
GO:0006820 anion transport No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006811 ion transport No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0015698 inorganic anion transport No
GO:0110165 cellular anatomical entity No
GO:0015075 ion transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 4 21 17
2 48 66 18
3 86 108 22
4 120 142 22
5 207 229 22
6 264 286 22
7 301 323 22
8 357 379 22
9 419 436 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4486
MNFYTANLLTLCAINAFLLFRRYRHRRPQITPISAARLETAQRFQRRFLAPYALAVAADWLQASLGPQRRYPDFR
LTSGKQLPEDVVARLYATGFVSAAASAMVAGRLVDSLGRRSACLFYCIFSGLACGLMLCSSMPLLVLGRVSGGIA
TTLLFSAFESWMISEYHLLELDDSVLSLKTVLENMALVNSAVAMISGVAGDALVEASGWRAAPFVAASLCCSIAA
PLLLTSWRENTRGGPVVQGRWKDYRLGIVTIVKSKRFSALAIATCCFEGAMYLFVFFWTAALNSARLQAGVEKEL
PLGLIFSSFMCAMMAGSLISTPVKAPSRQSATTDLCLTMAIGSSSLSCAVLFDDERIVFWAFCVLEATVGAYFPI
MGFLKSELVDDDRRGHVYSAVRLPLNLFVLVAHSLDEEGDKHRVRVFLTLAGLLVAASVVVKRGLT*
Coding >Ophun1|4486
ATGAACTTTTACACCGCAAACCTCCTGACGCTATGCGCCATCAACGCCTTCCTCCTCTTTCGAAGATACCGACAC
CGACGTCCTCAGATAACGCCCATCAGTGCCGCACGCCTGGAGACGGCTCAAAGATTCCAGCGACGCTTTCTCGCG
CCATATGCTCTCGCCGTCGCCGCCGACTGGTTGCAGGCCAGTCTTGGCCCGCAGCGTCGATACCCAGACTTCCGA
CTGACGAGTGGAAAGCAGCTGCCCGAGGACGTCGTCGCGCGCCTCTACGCCACCGGCTTCGTGTCCGCCGCTGCG
AGCGCCATGGTCGCTGGCCGGCTGGTTGACAGCCTCGGCAGACGTTCCGCATGCCTGTTCTATTGCATCTTCAGC
GGCCTTGCCTGTGGCTTGATGCTTTGCAGCAGCATGCCGCTCCTCGTGCTCGGCCGCGTTTCGGGCGGTATCGCG
ACCACGCTCCTCTTCAGCGCCTTCGAGTCTTGGATGATCTCCGAGTATCACCTGTTGGAGCTTGATGATTCGGTC
CTGTCGCTCAAGACAGTTCTTGAGAATATGGCGCTCGTCAACAGCGCCGTCGCCATGATTTCAGGCGTTGCGGGC
GATGCCCTCGTCGAGGCATCTGGGTGGCGAGCCGCGCCCTTTGTAGCCGCCAGTCTGTGCTGTTCGATTGCTGCT
CCCCTGCTGCTGACGTCGTGGCGCGAGAACACCCGCGGCGGACCCGTCGTCCAAGGCAGATGGAAGGACTATCGA
CTCGGCATCGTGACGATCGTGAAGAGCAAGCGTTTTTCGGCTCTGGCCATTGCCACATGTTGCTTCGAAGGAGCC
ATGTACCTCTTCGTCTTTTTCTGGACCGCGGCTCTCAACAGTGCTCGTCTCCAAGCTGGCGTCGAAAAGGAGCTC
CCGCTAGGACTCATCTTCTCGAGCTTCATGTGCGCCATGATGGCCGGTTCCCTGATCTCGACGCCAGTCAAGGCC
CCTTCGCGACAGAGCGCGACTACGGATCTGTGCCTGACCATGGCCATCGGCAGCAGCAGCCTATCGTGCGCCGTG
CTATTTGACGACGAACGGATTGTATTCTGGGCATTTTGCGTCCTGGAGGCTACCGTCGGTGCCTACTTTCCCATC
ATGGGGTTTCTGAAGAGCGAACTCGTCGACGACGACAGGCGAGGCCACGTGTATAGCGCTGTCCGTCTTCCTCTG
AACCTGTTTGTCTTGGTGGCGCATAGCCTGGACGAGGAGGGTGACAAGCACCGTGTCAGGGTGTTTCTGACGCTC
GCCGGGCTTTTGGTAGCGGCTTCGGTCGTAGTCAAACGAGGCCTGACCTGA
Transcript >Ophun1|4486
ATGAACTTTTACACCGCAAACCTCCTGACGCTATGCGCCATCAACGCCTTCCTCCTCTTTCGAAGATACCGACAC
CGACGTCCTCAGATAACGCCCATCAGTGCCGCACGCCTGGAGACGGCTCAAAGATTCCAGCGACGCTTTCTCGCG
CCATATGCTCTCGCCGTCGCCGCCGACTGGTTGCAGGCCAGTCTTGGCCCGCAGCGTCGATACCCAGACTTCCGA
CTGACGAGTGGAAAGCAGCTGCCCGAGGACGTCGTCGCGCGCCTCTACGCCACCGGCTTCGTGTCCGCCGCTGCG
AGCGCCATGGTCGCTGGCCGGCTGGTTGACAGCCTCGGCAGACGTTCCGCATGCCTGTTCTATTGCATCTTCAGC
GGCCTTGCCTGTGGCTTGATGCTTTGCAGCAGCATGCCGCTCCTCGTGCTCGGCCGCGTTTCGGGCGGTATCGCG
ACCACGCTCCTCTTCAGCGCCTTCGAGTCTTGGATGATCTCCGAGTATCACCTGTTGGAGCTTGATGATTCGGTC
CTGTCGCTCAAGACAGTTCTTGAGAATATGGCGCTCGTCAACAGCGCCGTCGCCATGATTTCAGGCGTTGCGGGC
GATGCCCTCGTCGAGGCATCTGGGTGGCGAGCCGCGCCCTTTGTAGCCGCCAGTCTGTGCTGTTCGATTGCTGCT
CCCCTGCTGCTGACGTCGTGGCGCGAGAACACCCGCGGCGGACCCGTCGTCCAAGGCAGATGGAAGGACTATCGA
CTCGGCATCGTGACGATCGTGAAGAGCAAGCGTTTTTCGGCTCTGGCCATTGCCACATGTTGCTTCGAAGGAGCC
ATGTACCTCTTCGTCTTTTTCTGGACCGCGGCTCTCAACAGTGCTCGTCTCCAAGCTGGCGTCGAAAAGGAGCTC
CCGCTAGGACTCATCTTCTCGAGCTTCATGTGCGCCATGATGGCCGGTTCCCTGATCTCGACGCCAGTCAAGGCC
CCTTCGCGACAGAGCGCGACTACGGATCTGTGCCTGACCATGGCCATCGGCAGCAGCAGCCTATCGTGCGCCGTG
CTATTTGACGACGAACGGATTGTATTCTGGGCATTTTGCGTCCTGGAGGCTACCGTCGGTGCCTACTTTCCCATC
ATGGGGTTTCTGAAGAGCGAACTCGTCGACGACGACAGGCGAGGCCACGTGTATAGCGCTGTCCGTCTTCCTCTG
AACCTGTTTGTCTTGGTGGCGCATAGCCTGGACGAGGAGGGTGACAAGCACCGTGTCAGGGTGTTTCTGACGCTC
GCCGGGCTTTTGGTAGCGGCTTCGGTCGTAGTCAAACGAGGCCTGACCTGA
Gene >Ophun1|4486
ATGAACTTTTACACCGCAAACCTCCTGACGCTATGCGCCATCAACGCCTTCCTCCTCTTTCGAAGATACCGACAC
CGACGTCCTCAGATAACGCCCATCAGTGCCGCACGCCTGGAGACGGCTCAAAGATTCCAGCGACGCTTTCTCGCG
CCATATGCTCTCGCCGTCGCCGCCGACTGGTTGCAGGCCAGTCTTGGCCCGCAGCGTCGATACCCAGACTTCCGA
CTGACGTGAGCGCCTCCAGGGACCGCACCTATACGCCTTGTATAGGAGTGGAAAGCAGCTGCCCGAGGACGTCGT
CGCGCGCCTCTACGCCACCGGCTTCGTGTCCGCCGCTGCGAGCGCCATGGTCGCTGGCCGGCTGGTTGACAGCCT
CGGCAGACGTTCCGCATGCCTGTTCTATTGCATCTTCAGCGGCCTTGCCTGTGGCTTGATGCTTTGCAGCAGCAT
GCCGCTCCTCGTGCTCGGCCGCGTTTCGGGCGGTATCGCGACCACGCTCCTCTTCAGCGCCTTCGAGTCTTGGAT
GATCTCCGAGTATCACCTGTTGGAGCTTGATGATTCGGTCCTGTCGCTCAAGACAGTTCTTGAGAATATGGCGCT
CGTCAACAGCGCCGTCGCCATGATTTCAGGCGTTGCGGGCGATGCCCTCGTCGAGGCATCTGGGTGGCGAGCCGC
GCCCTTTGTAGCCGCCAGTCTGTGCTGTTCGATTGCTGCTCCCCTGCTGCTGACGTCGTGGCGCGAGAACACCCG
CGGCGGACCCGTCGTCCAAGGCAGATGGAAGGACTATCGACTCGGCATCGTGACGATCGTGAAGAGCAAGCGTTT
TTCGGCTCTGGCCATTGCCACATGTTGCTTCGAAGGAGCCATGTACCTCTTCGTCTTTTTCTGGACCGCGGCTCT
CAACAGTGCTCGTCTCCAAGCTGGCGTCGAAAAGGAGCTCCCGCTAGGACTCATCTTCTCGAGCTTCATGTGCGC
CATGATGGCCGGTTCCCTGATCTCGACGCCAGTCAAGGCCCCTTCGCGACAGAGCGCGACTACGGATCTGTGCCT
GACCATGGCCATCGGCAGCAGCAGCCTATCGTGCGCCGTGCTATTTGACGACGAACGGATTGTATTCTGGGCATT
TTGCGTCCTGGAGGCTACCGTCGGTGCCTACTTTCCCATCATGGGGTTTCTGAAGAGCGAACTCGTCGACGACGA
CAGGCGAGGCCACGTGTATAGCGCTGTCCGTCTTCCTCTGAACCTGTTTGTCTTGGTGGCGCATAGCCTGGACGA
GGAGGGTAGGTGACGGAAGACGAGCCCTGGCCGAGCTGCGAGGCTGACTCGAGGTTGAGCAGGTGACAAGCACCG
TGTCAGGGTGTTTCTGACGCTCGCCGGGCTTTTGGTAGCGGCTTCGGTCGTAGTCAAACGAGGCCTGACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail