Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4482
Gene name
LocationContig_414:2037..2433
Strand-
Gene length (bp)396
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01096 TFIIS_C Transcription factor S-II (TFIIS) 7.3E-19 69 108
PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit 6.3E-06 4 33

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04307|RPC10_YEAST DNA-directed RNA polymerase III subunit RPC10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC11 PE=1 SV=1 1 110 3.0E-31
sp|O13896|RPC10_SCHPO DNA-directed RNA polymerase III subunit RPC10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc11 PE=3 SV=1 2 110 3.0E-30
sp|Q9Y2Y1|RPC10_HUMAN DNA-directed RNA polymerase III subunit RPC10 OS=Homo sapiens GN=POLR3K PE=1 SV=2 1 109 3.0E-28
sp|Q9CQZ7|RPC10_MOUSE DNA-directed RNA polymerase III subunit RPC10 OS=Mus musculus GN=Polr3k PE=3 SV=1 1 109 6.0E-28
sp|Q2M2S7|RPC10_BOVIN DNA-directed RNA polymerase III subunit RPC10 OS=Bos taurus GN=POLR3K PE=3 SV=1 1 109 3.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04307|RPC10_YEAST DNA-directed RNA polymerase III subunit RPC10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC11 PE=1 SV=1 1 110 3.0E-31
sp|O13896|RPC10_SCHPO DNA-directed RNA polymerase III subunit RPC10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc11 PE=3 SV=1 2 110 3.0E-30
sp|Q9Y2Y1|RPC10_HUMAN DNA-directed RNA polymerase III subunit RPC10 OS=Homo sapiens GN=POLR3K PE=1 SV=2 1 109 3.0E-28
sp|Q9CQZ7|RPC10_MOUSE DNA-directed RNA polymerase III subunit RPC10 OS=Mus musculus GN=Polr3k PE=3 SV=1 1 109 6.0E-28
sp|Q2M2S7|RPC10_BOVIN DNA-directed RNA polymerase III subunit RPC10 OS=Bos taurus GN=POLR3K PE=3 SV=1 1 109 3.0E-26
sp|Q58548|TFS_METJA Transcription factor S OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tfs PE=3 SV=1 1 109 2.0E-12
sp|Q9P9I8|TFS_METTL Transcription factor S OS=Methanothermococcus thermolithotrophicus GN=tfs PE=3 SV=1 1 109 9.0E-12
sp|Q07271|TFS_SULAC Transcription factor S OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tfs PE=3 SV=2 2 109 2.0E-10
sp|Q56254|TFS_THECE Transcription factor S OS=Thermococcus celer GN=tfs PE=1 SV=1 2 108 3.0E-10
sp|O29033|TFS_ARCFU Transcription factor S OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tfs PE=3 SV=1 4 109 1.0E-07
sp|O27369|TFS_METTH Transcription factor S OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=tfs PE=3 SV=2 2 109 5.0E-07
sp|P49373|TFS2_SCHPO Transcription elongation factor S-II OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfs1 PE=3 SV=1 49 108 2.0E-06
sp|Q6GZP4|081R_FRG3G Putative transcription elongation factor S-II-like protein 81R OS=Frog virus 3 (isolate Goorha) GN=FV3-081R PE=3 SV=1 62 107 5.0E-06
sp|P27999|RPB9_YEAST DNA-directed RNA polymerase II subunit RPB9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB9 PE=1 SV=1 4 105 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003676 nucleic acid binding Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046872 metal ion binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0046914 transition metal ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0043169 cation binding No
GO:0009059 macromolecule biosynthetic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0043167 ion binding No
GO:0090304 nucleic acid metabolic process No
GO:0032774 RNA biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Transcription factor TFIIS

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6261
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6631
Ophiocordyceps australis map64 (Brazil) OphauB2|3086
Ophiocordyceps camponoti-rufipedis Ophun1|4482 (this protein)
Ophiocordyceps kimflemingae Ophio5|614
Ophiocordyceps subramaniannii Hirsu2|7884

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4482
MLLFCPHCANILTVSLTNQRRNRLECRTCPFEHNVTEPVFSRRVYERKEKEDVFGGPGAWDNAQKGRVQCPAKGC
DGDEAAFFQVQIRSADEPMTSFFKCMTCGQRWREN*
Coding >Ophun1|4482
ATGCTCCTCTTCTGCCCCCACTGCGCAAACATCCTGACCGTCTCCCTCACCAACCAACGACGCAACCGCCTCGAA
TGCCGGACCTGTCCCTTCGAACACAACGTCACCGAGCCCGTCTTCTCGCGCCGCGTCTACGAGCGCAAGGAGAAG
GAGGATGTCTTCGGCGGGCCGGGCGCGTGGGACAATGCGCAAAAGGGCCGGGTGCAGTGTCCGGCCAAGGGCTGT
GACGGCGACGAGGCTGCTTTTTTCCAGGTGCAGATTCGGAGTGCTGATGAGCCCATGACGAGCTTTTTCAAGTGC
ATGACTTGTGGGCAGCGGTGGCGCGAGAACTGA
Transcript >Ophun1|4482
ATGCTCCTCTTCTGCCCCCACTGCGCAAACATCCTGACCGTCTCCCTCACCAACCAACGACGCAACCGCCTCGAA
TGCCGGACCTGTCCCTTCGAACACAACGTCACCGAGCCCGTCTTCTCGCGCCGCGTCTACGAGCGCAAGGAGAAG
GAGGATGTCTTCGGCGGGCCGGGCGCGTGGGACAATGCGCAAAAGGGCCGGGTGCAGTGTCCGGCCAAGGGCTGT
GACGGCGACGAGGCTGCTTTTTTCCAGGTGCAGATTCGGAGTGCTGATGAGCCCATGACGAGCTTTTTCAAGTGC
ATGACTTGTGGGCAGCGGTGGCGCGAGAACTGA
Gene >Ophun1|4482
ATGCTCCTCTGTACGCCCTTCCCAACCCCTAATCTCCAGAAATTATTCTAACGAGCCTGCCTGGCGCAACAAGTC
TGCCCCCACTGCGCAAACATCCTGACCGTCTCCCTCACCAACCAACGACGCAACCGCCTCGAATGCCGGACCTGT
CCCTTCGAACACAACGTCACCGAGCCCGTCTTCTCGCGCCGCGTCTACGAGCGCAAGGAGAAGGAGGATGTCTTC
GGCGGGCCGGGCGCGTGGGACAATGCGCAAAAGGGCCGGGTGCAGTGTCCGGCCAAGGGCTGTGACGGCGACGAG
GCTGCTTTTTTCCAGGTGCAGATTCGGAGTGCTGATGAGCCCATGACGAGCTTTTTCAAGTGCATGACTTGTGGG
CAGCGGTGGCGCGAGAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail