Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4479
Gene name
LocationContig_413:11934..14245
Strand+
Gene length (bp)2311
Transcript length (bp)1782
Coding sequence length (bp)1782
Protein length (aa) 594

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00855 PWWP PWWP domain 4.8E-14 133 239
PF08711 Med26 TFIIS helical bundle-like domain 3.2E-04 422 473

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94312|PDP2_SCHPO PWWP domain-containing protein2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdp2 PE=1 SV=1 385 566 2.0E-09
sp|Q09842|PDP3_SCHPO PWWP domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdp3 PE=1 SV=1 298 497 8.0E-08
sp|O59676|PDP1_SCHPO PWWP domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdp1 PE=1 SV=1 387 479 2.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3521
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4222
Ophiocordyceps australis map64 (Brazil) OphauB2|1853
Ophiocordyceps camponoti-floridani Ophcf2|04555
Ophiocordyceps camponoti-rufipedis Ophun1|4479 (this protein)
Ophiocordyceps kimflemingae Ophio5|859
Ophiocordyceps subramaniannii Hirsu2|6748

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4479
MADKPTDTAAPIDKAATPTPQGDGQEPGDKEPSNETKLAAEAPEKTEAAAADDDQEAVEKPAAQDEKGQEKAADV
DVEMKDAVEEPAAPEPGPATVKTKGASRRKSSLGEAKGKTLAKKASKARLSHVDAKPGDHFLVKLKGHPAWPAIV
CDETMLPAALISSRPVSAARSDGSYADAYADRGKRVHDRSFPVMYLYTNEFGWAQNSTLSELTAEKAKDTITEKM
RKDLRAAYELAAEHNDIEHYKEILQSFQEEQIAQEEARKQTVTLKKAKKGKGKALEDDDDLDIEMDDAHVVPKSA
KSKKRKAEDDTSTPQRPDSVKKPKIKLNTSSTPKTANGAATPKSAGASAAKGSKSKPKKAKDGGDKKAETPKEAK
MTPEERRARKEKEVLYLRHKLQRGLLTREQQPREDEMKTMSDFVTVLENMVDLEVSIIRATKINKVLKAILKLDS
IPREEDFEFKKRSQSLLDKWNKLLADDGSAGTNGVNGAAEDKKGKANGVEDDAGEASKGGEDKAEAEKTEKGGEE
DSVAEDKAEGAEETEAGEDKTESADKEADKEADKETDKEADKETVKEADKEAVKAATPAADVTSDAEN*
Coding >Ophun1|4479
ATGGCCGACAAGCCGACGGATACGGCGGCGCCCATCGACAAGGCTGCCACGCCGACGCCTCAGGGGGACGGGCAG
GAGCCGGGAGACAAGGAGCCTTCCAACGAGACTAAGCTTGCTGCCGAGGCCCCCGAGAAAACAGAGGCTGCTGCC
GCCGACGACGACCAAGAGGCTGTCGAGAAGCCAGCTGCTCAAGACGAAAAGGGGCAGGAAAAGGCCGCCGACGTC
GACGTCGAGATGAAGGACGCCGTCGAGGAACCGGCCGCTCCCGAGCCTGGACCCGCCACTGTCAAAACCAAGGGC
GCCAGTCGTCGCAAGTCGAGCCTCGGGGAGGCCAAGGGCAAGACGTTGGCCAAGAAGGCATCCAAGGCACGTCTC
AGCCACGTCGACGCGAAACCCGGCGACCACTTCCTCGTCAAGCTCAAGGGTCATCCCGCCTGGCCCGCCATCGTT
TGCGACGAGACCATGCTGCCCGCTGCTCTCATCAGCAGCCGGCCTGTCTCGGCTGCCAGGTCAGATGGAAGCTAC
GCCGACGCTTATGCCGACAGAGGCAAGCGTGTCCACGACAGAAGTTTTCCCGTCATGTATCTCTACACCAACGAA
TTTGGATGGGCTCAGAACTCGACCCTCTCGGAACTCACGGCTGAAAAGGCCAAGGACACCATCACGGAAAAGATG
CGCAAGGACCTTAGGGCCGCGTACGAGCTCGCTGCCGAACACAACGACATCGAGCACTACAAGGAGATTCTCCAG
TCCTTCCAGGAGGAGCAGATTGCGCAGGAAGAGGCCAGGAAGCAGACCGTCACCCTCAAAAAGGCCAAGAAGGGC
AAGGGCAAGGCCCTCGAAGACGATGACGACCTCGACATCGAAATGGATGATGCCCACGTCGTTCCCAAATCGGCC
AAATCCAAGAAGCGAAAGGCCGAGGACGACACCAGCACTCCTCAGAGACCCGACTCGGTCAAGAAGCCCAAGATC
AAGCTCAACACGTCGTCGACTCCCAAGACGGCCAACGGAGCCGCCACGCCCAAGTCGGCCGGTGCTTCTGCCGCC
AAGGGTTCCAAGTCGAAGCCTAAGAAGGCCAAAGACGGGGGCGACAAGAAGGCGGAGACGCCCAAGGAGGCCAAG
ATGACTCCGGAGGAGCGCAGGGCTCGGAAAGAGAAAGAGGTCCTCTACCTCCGTCACAAGCTCCAGCGGGGCCTC
CTTACCAGGGAGCAGCAGCCGCGGGAGGATGAGATGAAGACCATGTCGGACTTTGTCACGGTGCTGGAGAACATG
GTCGACCTCGAGGTCTCCATCATCAGGGCCACCAAGATCAACAAGGTGCTCAAGGCCATCCTCAAGCTCGACTCG
ATCCCGCGCGAGGAGGACTTTGAGTTCAAAAAGAGATCGCAGTCGCTGCTCGACAAGTGGAACAAGCTGCTCGCC
GACGACGGCTCGGCTGGGACCAACGGCGTCAACGGGGCGGCCGAGGATAAGAAGGGCAAGGCCAATGGCGTCGAG
GACGATGCCGGCGAGGCCTCCAAGGGCGGCGAGGACAAGGCCGAAGCGGAGAAGACTGAGAAGGGCGGCGAGGAA
GACTCGGTCGCCGAGGACAAGGCTGAGGGTGCCGAGGAGACGGAAGCCGGCGAGGACAAGACGGAGTCGGCCGAC
AAGGAAGCCGACAAGGAGGCTGACAAGGAGACTGACAAGGAGGCCGACAAGGAAACCGTCAAGGAGGCCGACAAG
GAGGCCGTCAAGGCAGCGACTCCCGCAGCGGACGTCACTTCGGATGCGGAAAACTAA
Transcript >Ophun1|4479
ATGGCCGACAAGCCGACGGATACGGCGGCGCCCATCGACAAGGCTGCCACGCCGACGCCTCAGGGGGACGGGCAG
GAGCCGGGAGACAAGGAGCCTTCCAACGAGACTAAGCTTGCTGCCGAGGCCCCCGAGAAAACAGAGGCTGCTGCC
GCCGACGACGACCAAGAGGCTGTCGAGAAGCCAGCTGCTCAAGACGAAAAGGGGCAGGAAAAGGCCGCCGACGTC
GACGTCGAGATGAAGGACGCCGTCGAGGAACCGGCCGCTCCCGAGCCTGGACCCGCCACTGTCAAAACCAAGGGC
GCCAGTCGTCGCAAGTCGAGCCTCGGGGAGGCCAAGGGCAAGACGTTGGCCAAGAAGGCATCCAAGGCACGTCTC
AGCCACGTCGACGCGAAACCCGGCGACCACTTCCTCGTCAAGCTCAAGGGTCATCCCGCCTGGCCCGCCATCGTT
TGCGACGAGACCATGCTGCCCGCTGCTCTCATCAGCAGCCGGCCTGTCTCGGCTGCCAGGTCAGATGGAAGCTAC
GCCGACGCTTATGCCGACAGAGGCAAGCGTGTCCACGACAGAAGTTTTCCCGTCATGTATCTCTACACCAACGAA
TTTGGATGGGCTCAGAACTCGACCCTCTCGGAACTCACGGCTGAAAAGGCCAAGGACACCATCACGGAAAAGATG
CGCAAGGACCTTAGGGCCGCGTACGAGCTCGCTGCCGAACACAACGACATCGAGCACTACAAGGAGATTCTCCAG
TCCTTCCAGGAGGAGCAGATTGCGCAGGAAGAGGCCAGGAAGCAGACCGTCACCCTCAAAAAGGCCAAGAAGGGC
AAGGGCAAGGCCCTCGAAGACGATGACGACCTCGACATCGAAATGGATGATGCCCACGTCGTTCCCAAATCGGCC
AAATCCAAGAAGCGAAAGGCCGAGGACGACACCAGCACTCCTCAGAGACCCGACTCGGTCAAGAAGCCCAAGATC
AAGCTCAACACGTCGTCGACTCCCAAGACGGCCAACGGAGCCGCCACGCCCAAGTCGGCCGGTGCTTCTGCCGCC
AAGGGTTCCAAGTCGAAGCCTAAGAAGGCCAAAGACGGGGGCGACAAGAAGGCGGAGACGCCCAAGGAGGCCAAG
ATGACTCCGGAGGAGCGCAGGGCTCGGAAAGAGAAAGAGGTCCTCTACCTCCGTCACAAGCTCCAGCGGGGCCTC
CTTACCAGGGAGCAGCAGCCGCGGGAGGATGAGATGAAGACCATGTCGGACTTTGTCACGGTGCTGGAGAACATG
GTCGACCTCGAGGTCTCCATCATCAGGGCCACCAAGATCAACAAGGTGCTCAAGGCCATCCTCAAGCTCGACTCG
ATCCCGCGCGAGGAGGACTTTGAGTTCAAAAAGAGATCGCAGTCGCTGCTCGACAAGTGGAACAAGCTGCTCGCC
GACGACGGCTCGGCTGGGACCAACGGCGTCAACGGGGCGGCCGAGGATAAGAAGGGCAAGGCCAATGGCGTCGAG
GACGATGCCGGCGAGGCCTCCAAGGGCGGCGAGGACAAGGCCGAAGCGGAGAAGACTGAGAAGGGCGGCGAGGAA
GACTCGGTCGCCGAGGACAAGGCTGAGGGTGCCGAGGAGACGGAAGCCGGCGAGGACAAGACGGAGTCGGCCGAC
AAGGAAGCCGACAAGGAGGCTGACAAGGAGACTGACAAGGAGGCCGACAAGGAAACCGTCAAGGAGGCCGACAAG
GAGGCCGTCAAGGCAGCGACTCCCGCAGCGGACGTCACTTCGGATGCGGAAAACTAA
Gene >Ophun1|4479
ATGGCCGACAAGCCGACGGATACGGCGGCGCCCATCGACAAGGCTGCCACGCCGACGCCTCAGGGGGACGGGCAG
GAGCCGGGAGACAAGGAGCCTTCCAACGAGACTAAGCTTGCTGGTGAGTTTTCGCGGTGCTCGTCTGACGCGTCG
TGTCTCCTCTGTCTCGACTCTTCGTCTCTGCCCAGCTTCCCCCTTGTTCTATCCTGTTCTTCCTTCTTTCGCTCG
CTCCGTTCAATCCCTTTTTGCCTGTTGCAGGTCCACCTTTTGTCCTGGCAGTTGTGCGGCCAATTCGAGTGGGAA
AATTCTGCATCTGTTTACCAAACCCCTCCACCTCGCCTTTGTTCCCTCTTCCCCCTTTCCCTTGCGCTCGAGACG
ACTCTCTTTGTGTGGCGGCAGTTACGCTGACGACGTCATCAATTAGTAGCCGAGGCCCCCGAGAAAACAGAGGCT
GCTGCCGCCGACGACGACCAAGAGGCTGTCGAGAAGCCAGCTGCTCAAGACGAAAAGGGGCAGGAAAAGGCCGCC
GACGTCGACGTCGAGATGAAGGACGCCGTCGAGGAACCGGCCGCTCCCGAGCCTGGACCCGCCACTGTCAAAACC
AAGGGCGCCAGTCGTCGCAAGTCGAGCCTCGGGGAGGCCAAGGGCAAGACGTTGGCCAAGAAGGCATCCAAGGCA
CGTCTCAGCCACGTCGACGCGAAACCCGGCGACCACTTCCTCGTCAAGCTCAAGGGTCATCCCGCCTGGCCCGCC
ATCGTTTGCGACGAGACCATGCTGCCCGCTGCTCTCATCAGCAGCCGGCCTGTCTCGGCTGCCAGGTCAGATGGA
AGCTACGCCGACGCTTATGCCGACAGAGGCAAGCGTGTCCACGACAGAAGTTTTCCCGTCATGTATCTCTACACC
AACGAATTGTGAGTTGTCCCCTGGCGATGCCCTACACTTGAGCTGACTCGACCCTTTTTTACAGTGGATGGGCTC
AGAACTCGACCCTCTCGGAACTCACGGCTGAAAAGGCCAAGGACACCATCACGGAAAAGATGCGCAAGGACCTTA
GGGCCGCGTACGAGCTCGCTGCCGAACACAACGACATCGAGCACTACAAGGAGATTCTCCAGTCCTTCCAGGAGG
AGCAGATTGCGCAGGAAGAGGCCAGGAAGCAGACCGTCACCCTCAAAAAGGCCAAGAAGGGCAAGGGCAAGGCCC
TCGAAGACGATGACGACCTCGACATCGAAATGGATGATGCCCACGTCGTTCCCAAATCGGCCAAATCCAAGAAGC
GAAAGGCCGAGGACGACACCAGCGTAAGTGATATCCCCCCCTGAGAGCTTTTTTTTTGGGGGGGCTGACGTGCGG
ATCGTACCAGACTCCTCAGAGACCCGACTCGGTCAAGAAGCCCAAGATCAAGCTCAACACGTCGTCGACTCCCAA
GACGGCCAACGGAGCCGCCACGCCCAAGTCGGCCGGTGCTTCTGCCGCCAAGGGTTCCAAGTCGAAGCCTAAGAA
GGCCAAAGACGGGGGCGACAAGAAGGCGGAGACGCCCAAGGAGGCCAAGATGACTCCGGAGGAGCGCAGGGCTCG
GAAAGAGGTACGTGGCCCCCGGATGGCAGAGCATCGACAAGTCTGACGGACGCTCGCAGAAAGAGGTCCTCTACC
TCCGTCACAAGCTCCAGCGGGGCCTCCTTACCAGGGAGCAGCAGCCGCGGGAGGATGAGATGAAGACCATGTCGG
ACTTTGTCACGGTGCTGGAGAACATGGTCGACCTCGAGGTCTCCATCATCAGGGCCACCAAGATCAACAAGGTGC
TCAAGGCCATCCTCAAGCTCGACTCGATCCCGCGCGAGGAGGACTTTGAGTTCAAAAAGAGATCGCAGTCGCTGC
TCGACAAGTGGAACAAGCTGCTCGCCGACGACGGCTCGGCTGGGACCAACGGCGTCAACGGGGCGGCCGAGGATA
AGAAGGGCAAGGCCAATGGCGTCGAGGACGATGCCGGCGAGGCCTCCAAGGGCGGCGAGGACAAGGCCGAAGCGG
AGAAGACTGAGAAGGGCGGCGAGGAAGACTCGGTCGCCGAGGACAAGGCTGAGGGTGCCGAGGAGACGGAAGCCG
GCGAGGACAAGACGGAGTCGGCCGACAAGGAAGCCGACAAGGAGGCTGACAAGGAGACTGACAAGGAGGCCGACA
AGGAAACCGTCAAGGAGGCCGACAAGGAGGCCGTCAAGGCAGCGACTCCCGCAGCGGTACGTTGTCACTCGTCGT
GTGTCGTGATGTGAGCTGACATTTCTCGGGCCAGGACGTCACTTCGGATGCGGAAAACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail