Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4473
Gene name
LocationContig_412:9641..11771
Strand+
Gene length (bp)2130
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13664 DUF4149 Domain of unknown function (DUF4149) 5.2E-23 15 124
PF13242 Hydrolase_like HAD-hyrolase-like 2.2E-13 375 450
PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase 2.1E-07 214 277

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00472|PNPP_SCHPO 4-nitrophenylphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pho2 PE=4 SV=2 215 451 4.0E-60
sp|P19881|PNPP_YEAST 4-nitrophenylphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO13 PE=1 SV=2 215 451 8.0E-42
sp|Q8GWU0|PGP2_ARATH Phosphoglycolate phosphatase 2 OS=Arabidopsis thaliana GN=PGLP2 PE=1 SV=1 215 452 2.0E-36
sp|P0DKC4|PGP1B_ARATH Phosphoglycolate phosphatase 1B, chloroplastic OS=Arabidopsis thaliana GN=PGLP1B PE=1 SV=1 215 455 3.0E-36
sp|P0DKC3|PGP1A_ARATH Phosphoglycolate phosphatase 1A, chloroplastic OS=Arabidopsis thaliana GN=PGLP1A PE=1 SV=1 215 455 3.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00472|PNPP_SCHPO 4-nitrophenylphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pho2 PE=4 SV=2 215 451 4.0E-60
sp|P19881|PNPP_YEAST 4-nitrophenylphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO13 PE=1 SV=2 215 451 8.0E-42
sp|Q8GWU0|PGP2_ARATH Phosphoglycolate phosphatase 2 OS=Arabidopsis thaliana GN=PGLP2 PE=1 SV=1 215 452 2.0E-36
sp|P0DKC4|PGP1B_ARATH Phosphoglycolate phosphatase 1B, chloroplastic OS=Arabidopsis thaliana GN=PGLP1B PE=1 SV=1 215 455 3.0E-36
sp|P0DKC3|PGP1A_ARATH Phosphoglycolate phosphatase 1A, chloroplastic OS=Arabidopsis thaliana GN=PGLP1A PE=1 SV=1 215 455 3.0E-36
sp|Q2T9S4|PGP_BOVIN Phosphoglycolate phosphatase OS=Bos taurus GN=PGP PE=2 SV=1 215 454 1.0E-31
sp|Q8CHP8|PGP_MOUSE Phosphoglycolate phosphatase OS=Mus musculus GN=Pgp PE=1 SV=1 215 454 2.0E-30
sp|A6NDG6|PGP_HUMAN Phosphoglycolate phosphatase OS=Homo sapiens GN=PGP PE=1 SV=1 215 454 1.0E-28
sp|Q49W68|NAGD_STAS1 Acid sugar phosphatase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=nagD PE=3 SV=1 204 447 1.0E-24
sp|Q5F4B1|PGP_CHICK Phosphoglycolate phosphatase OS=Gallus gallus GN=PGP PE=2 SV=1 215 454 2.0E-24
sp|O32125|YUTF_BACSU Acid sugar phosphatase OS=Bacillus subtilis (strain 168) GN=yutF PE=1 SV=1 215 452 1.0E-23
sp|Q4L4U2|NAGD_STAHJ Acid sugar phosphatase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=nagD PE=3 SV=1 205 443 1.0E-21
sp|Q3ZBF9|PLPP_BOVIN Pyridoxal phosphate phosphatase OS=Bos taurus GN=PDXP PE=1 SV=1 215 452 2.0E-20
sp|Q96GD0|PLPP_HUMAN Pyridoxal phosphate phosphatase OS=Homo sapiens GN=PDXP PE=1 SV=2 215 451 1.0E-19
sp|Q5HQN3|NAGD_STAEQ Acid sugar phosphatase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=nagD PE=3 SV=1 207 455 2.0E-19
sp|Q8VD52|PLPP_RAT Pyridoxal phosphate phosphatase OS=Rattus norvegicus GN=Pdxp PE=1 SV=2 214 452 2.0E-19
sp|Q8CPW3|NAGD_STAES Acid sugar phosphatase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=nagD PE=3 SV=1 207 455 3.0E-19
sp|Q7A1D4|NAGD_STAAW Acid sugar phosphatase OS=Staphylococcus aureus (strain MW2) GN=nagD PE=3 SV=1 207 447 1.0E-18
sp|Q6GAZ7|NAGD_STAAS Acid sugar phosphatase OS=Staphylococcus aureus (strain MSSA476) GN=nagD PE=3 SV=1 207 447 1.0E-18
sp|Q7A6K4|NAGD_STAAN Acid sugar phosphatase OS=Staphylococcus aureus (strain N315) GN=nagD PE=3 SV=1 207 447 1.0E-18
sp|Q99VE8|NAGD_STAAM Acid sugar phosphatase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=nagD PE=3 SV=1 207 447 1.0E-18
sp|Q5HHF6|NAGD_STAAC Acid sugar phosphatase OS=Staphylococcus aureus (strain COL) GN=nagD PE=3 SV=1 207 447 1.0E-18
sp|Q2FZX0|NAGD_STAA8 Acid sugar phosphatase OS=Staphylococcus aureus (strain NCTC 8325) GN=nagD PE=3 SV=1 207 447 1.0E-18
sp|Q2FIE5|NAGD_STAA3 Acid sugar phosphatase OS=Staphylococcus aureus (strain USA300) GN=nagD PE=3 SV=1 207 447 1.0E-18
sp|P60487|PLPP_MOUSE Pyridoxal phosphate phosphatase OS=Mus musculus GN=Pdxp PE=1 SV=1 215 452 2.0E-18
sp|Q6GIF9|NAGD_STAAR Acid sugar phosphatase OS=Staphylococcus aureus (strain MRSA252) GN=nagD PE=3 SV=1 207 447 4.0E-18
sp|Q2YWR1|NAGD_STAAB Acid sugar phosphatase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=nagD PE=3 SV=1 207 447 8.0E-18
sp|P34492|YMQ1_CAEEL Putative NipSnap protein K02D10.1 OS=Caenorhabditis elegans GN=K02D10.1 PE=2 SV=4 199 419 3.0E-17
sp|Q06089|YP098_YEAST Uncharacterized mitochondrial outer membrane protein YPR098C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR098C PE=1 SV=2 13 173 1.0E-15
sp|P46351|YTH1_PANTH Uncharacterized 45.4 kDa protein in thiaminase I 5'region OS=Paenibacillus thiaminolyticus PE=3 SV=1 216 438 2.0E-08
sp|P0AF24|NAGD_ECOLI Ribonucleotide monophosphatase NagD OS=Escherichia coli (strain K12) GN=nagD PE=1 SV=1 226 431 5.0E-08
sp|P0AF25|NAGD_ECO57 Ribonucleotide monophosphatase NagD OS=Escherichia coli O157:H7 GN=nagD PE=3 SV=1 226 431 5.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 53 75 22
3 95 117 22
4 151 173 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4473
MAESVIFSVAPYHIVSYGTLLGASIFHSFINGPVMYKSIDRPSFSAAQQNLFPIYFGLQTALPVALALTFPGSTL
AGVPSSVGGLLDVSSRWDSLVPIATMFVTSVVNLTVLLPATVKTMKERRGQCKRDGKEWDAPGPHSEKMKELNKR
FGMLHGISSLINLVTVLSACLTGDKAAIDSFINSFDVSEPSLLLLPRALTQPPDIPLRLRRRVEKSRQQYAQKLD
GLGIPSNADDVFGSSYSAAVYIARILKLPAEKNKVFVIGEAGVEAELAAEGVPFIGGSDEAFRRDVTPADFGGIA
DGSLLDSHVGVVLCGLDFHINYLKLAHALHYLRRGALFLATNLDSTLPMHHDLFIGAGSVLAPLVNATGQRPLPL
GKPSQAMMDAIEGKFRLDRSRTCMIGDRLDTDIKFGIDGKLGGTLHVQTGVNKKEDWQKTDAIAVPSFYADKLSD
LLLAK*
Coding >Ophun1|4473
ATGGCAGAATCCGTCATCTTCTCCGTGGCTCCGTACCACATCGTGTCCTACGGGACTCTACTGGGCGCCTCCATC
TTTCACTCCTTCATCAACGGCCCCGTCATGTACAAGTCCATCGACAGGCCTTCCTTCTCGGCCGCGCAGCAGAAC
CTCTTCCCCATCTACTTCGGCCTGCAGACGGCTCTTCCGGTGGCACTGGCCCTCACGTTCCCCGGGAGCACGCTG
GCGGGAGTGCCGAGCAGCGTGGGCGGGCTGCTGGATGTGTCGTCGCGGTGGGACTCGCTGGTGCCGATAGCGACC
ATGTTCGTCACGAGCGTTGTCAACCTGACGGTTCTGCTTCCGGCGACTGTGAAGACGATGAAGGAGCGGCGAGGC
CAGTGCAAACGGGACGGCAAGGAGTGGGATGCGCCGGGGCCGCATTCGGAGAAGATGAAGGAGCTGAACAAGAGG
TTTGGCATGTTGCATGGCATCTCTTCGCTTATCAATCTCGTTACCGTGCTGTCGGCGTGTCTCACCGGCGACAAA
GCCGCCATCGACAGCTTCATCAACAGCTTCGACGTCAGTGAACCCAGCCTCCTCCTGCTTCCGCGCGCGCTCACC
CAACCGCCAGACATTCCTCTTCGACTGCGACGGCGAGTTGAAAAGTCGCGGCAGCAGTATGCCCAGAAACTCGAT
GGCCTCGGTATCCCCAGCAACGCCGACGACGTCTTCGGATCCTCGTACTCGGCCGCCGTCTACATCGCTCGAATA
CTCAAGCTGCCGGCGGAGAAGAACAAGGTGTTTGTCATTGGCGAGGCTGGTGTTGAGGCTGAGCTTGCTGCCGAG
GGTGTCCCTTTTATAGGAGGTTCTGACGAGGCGTTTCGGCGTGACGTGACGCCCGCTGACTTTGGCGGCATTGCT
GATGGATCGTTGCTTGATTCGCATGTCGGTGTCGTTTTATGTGGACTCGACTTTCATATCAACTACCTTAAGCTC
GCCCACGCACTGCATTACCTCCGCCGCGGCGCCCTCTTCCTCGCCACAAACCTGGATTCGACCCTTCCTATGCAC
CACGATCTCTTCATCGGCGCCGGCTCTGTCTTGGCGCCCCTCGTCAACGCTACGGGTCAGAGACCGCTCCCGCTG
GGCAAGCCGAGTCAGGCCATGATGGATGCTATTGAGGGCAAGTTTCGCCTCGACCGGTCTAGAACGTGCATGATT
GGCGATAGACTCGACACGGACATCAAGTTCGGCATCGACGGCAAGCTCGGTGGTACTCTTCATGTGCAGACGGGG
GTGAATAAGAAGGAGGATTGGCAGAAGACGGACGCCATTGCTGTCCCGTCCTTTTATGCTGACAAGTTGAGCGAC
TTGCTACTAGCTAAGTGA
Transcript >Ophun1|4473
ATGGCAGAATCCGTCATCTTCTCCGTGGCTCCGTACCACATCGTGTCCTACGGGACTCTACTGGGCGCCTCCATC
TTTCACTCCTTCATCAACGGCCCCGTCATGTACAAGTCCATCGACAGGCCTTCCTTCTCGGCCGCGCAGCAGAAC
CTCTTCCCCATCTACTTCGGCCTGCAGACGGCTCTTCCGGTGGCACTGGCCCTCACGTTCCCCGGGAGCACGCTG
GCGGGAGTGCCGAGCAGCGTGGGCGGGCTGCTGGATGTGTCGTCGCGGTGGGACTCGCTGGTGCCGATAGCGACC
ATGTTCGTCACGAGCGTTGTCAACCTGACGGTTCTGCTTCCGGCGACTGTGAAGACGATGAAGGAGCGGCGAGGC
CAGTGCAAACGGGACGGCAAGGAGTGGGATGCGCCGGGGCCGCATTCGGAGAAGATGAAGGAGCTGAACAAGAGG
TTTGGCATGTTGCATGGCATCTCTTCGCTTATCAATCTCGTTACCGTGCTGTCGGCGTGTCTCACCGGCGACAAA
GCCGCCATCGACAGCTTCATCAACAGCTTCGACGTCAGTGAACCCAGCCTCCTCCTGCTTCCGCGCGCGCTCACC
CAACCGCCAGACATTCCTCTTCGACTGCGACGGCGAGTTGAAAAGTCGCGGCAGCAGTATGCCCAGAAACTCGAT
GGCCTCGGTATCCCCAGCAACGCCGACGACGTCTTCGGATCCTCGTACTCGGCCGCCGTCTACATCGCTCGAATA
CTCAAGCTGCCGGCGGAGAAGAACAAGGTGTTTGTCATTGGCGAGGCTGGTGTTGAGGCTGAGCTTGCTGCCGAG
GGTGTCCCTTTTATAGGAGGTTCTGACGAGGCGTTTCGGCGTGACGTGACGCCCGCTGACTTTGGCGGCATTGCT
GATGGATCGTTGCTTGATTCGCATGTCGGTGTCGTTTTATGTGGACTCGACTTTCATATCAACTACCTTAAGCTC
GCCCACGCACTGCATTACCTCCGCCGCGGCGCCCTCTTCCTCGCCACAAACCTGGATTCGACCCTTCCTATGCAC
CACGATCTCTTCATCGGCGCCGGCTCTGTCTTGGCGCCCCTCGTCAACGCTACGGGTCAGAGACCGCTCCCGCTG
GGCAAGCCGAGTCAGGCCATGATGGATGCTATTGAGGGCAAGTTTCGCCTCGACCGGTCTAGAACGTGCATGATT
GGCGATAGACTCGACACGGACATCAAGTTCGGCATCGACGGCAAGCTCGGTGGTACTCTTCATGTGCAGACGGGG
GTGAATAAGAAGGAGGATTGGCAGAAGACGGACGCCATTGCTGTCCCGTCCTTTTATGCTGACAAGTTGAGCGAC
TTGCTACTAGCTAAGTGA
Gene >Ophun1|4473
ATGGCAGAATCCGTCATCTTCTCCGTGGCTCCGTACCACATCGTGTCGTACGTCTTCAACAGTCAATTGGTCTGA
GCCCGCTAACATGTGCGCCTCAGCTACGGGACTCTACTGGGCGCCTCCATCTTTCACGTACCTCTCCCGATCATG
AGAGCGGATGCTCAGACCGACTGACGAGACACATCAGTCCTTCATCAACGGCCCCGTCATGTACAAGTCCATCGA
CAGGCCTTCCTTCTCGGCCGCGCAGCAGAACCTCTTCCCCATCTACTTCGGCCTGCAGACGGCTCTTCCGGTGGC
ACTGGCCCTCACGTTCCCCGGGAGCACGCTGGCGGGAGTGCCGAGCAGCGTGGGCGGGCTGCTGGATGTGTCGTC
GCGGTGGGACTCGCTGGTGCCGATAGCGACCATGTTCGTCACGAGCGTTGTCAACCTGACGGTTCTGCTTCCGGC
GACTGTGAAGACGATGAAGGAGCGGCGAGGCCAGTGTATGTTCCTGTTCACGGAGGATACGCTCTGGTCTTTTTG
CGCTTTTCATGGCTGACTTGGTGGTAGGCAAACGGGACGGCAAGGAGTGGGATGCGCCGGGGCCGCATTCGGAGA
AGATGAAGGAGCTGAACAAGAGGTTTGGCATGTTGCATGGCATCTCTTCGCTTATCAATCTCGTTACCGTGCTGT
CGGCGGTGGGTTATGGGTTTACGCTTGGGGGGCGGATGCAGTCCCTTGCTGATAGGCTCGGTTGATGCGTCTGGC
TGGCTTCGAGCTTGTTAGATGTTTGTTGTTATTAGGGGCCTGATAGTAGATAGTGCAGCTTCTTATCTTTGTTCA
CAGATGAGAAAGGGGCCGTATCATGATGTTGTTTCGCCATAGAGCTGTGTACTGTGTCAAGTGTCTCAACTAGCA
CTGTTGTCAACCTCAAGCTCAAGACTCCACGAACAAGGCTTCTTCTCCCTCTCCAACCGCCACAGACGACTCTCA
CCAACAGCTTCCGATAATCGCAAAGCCCTTCAATCGAGTCTCTCCACCGTTCTACAAAGTACCATGGCTGCCTCG
CCAAAGTGTCTCACCGGCGACAAAGCCGCCATCGACAGCTTCATCAACAGCTTCGACGTCAGTGAACCCAGCCTC
CTCCTGCTTCCGCGCGCGCTCACCCAACCGCCAGACATTCCTCTTCGACTGCGACGGCGAGTTGAAAAGGTCCGC
TGAAGGCTGGACGCGACTGACGTGGCGTAGGCGTGCTGTGGTCGGGAGACGAGGTCTTTGATGGCGTGCCGGAAA
CGCTGGCGCTGCTTCGCTCTAGAGGTACAGACCCATCTCTCACTCTCTACGCCTCGAATCTTGGCTGATTTTTTT
TTTTGCTGTTGGTGGCAAGGCAAACGCACCGTCTTCGTGACGAATAACTCGACAAAGTCGCGGCAGCAGTATGCC
CAGAAACTCGATGGCCTCGGTATCCCCAGCAACGCCGACGACGTCTTCGGATCCTCGTACTCGGCCGCCGTCTAC
ATCGCTCGAATACTCAAGCTGCCGGCGGAGAAGAACAAGGTGTTTGTCATTGGCGAGGCTGGTGTTGAGGCTGAG
CTTGCTGCCGAGGGTGTCCCTTTTATAGGAGGTTCTGACGAGGCGTTTCGGCGTGACGTGACGCCCGCTGACTTT
GGCGGCATTGCTGATGGATCGTTGCTTGATTCGCATGTCGGTGTCGTTTTATGTGGACTCGACTTTCATATCAAC
TACCTTAAGCTCGCCCACGCACTGCATTACCTCCGCCGCGGCGCCCTCTTCCTCGCCACAAACCTGGATTCGACC
CTTCCTATGCACCACGATCTCTTCATCGGCGCCGGCTCTGTCTTGGCGCCCCTCGTCAACGCTACGGGTCAGAGA
CCGCTCCCGCTGGGCAAGCCGAGTCAGGCCATGATGGATGCTATTGAGGGCAAGTTTCGCCTCGACCGGTCTAGA
ACGTGCATGATTGGCGATAGACTCGACACGGACATCAAGTTCGGCATCGACGGCAAGCTCGGTGGTACTCTTCAT
GTGCAGACGGGGGTGAATAAGAAGGAGGATTGGCAGAAGACGGACGCCATTGCTGTCCCGTCCTTTTATGCTGAC
AAGTTGAGCGACTTGCTACTAGCTAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail