Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4464
Gene name
LocationContig_410:13227..16537
Strand-
Gene length (bp)3310
Transcript length (bp)3159
Coding sequence length (bp)3159
Protein length (aa) 1053

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13886 DUF4203 Domain of unknown function (DUF4203) 1.5E-52 118 323

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 113 135 22
3 142 164 22
4 169 191 22
5 198 220 22
6 224 243 19
7 250 272 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4464
MLPKAARLTALLTLLLLTLHLVAAQNPPPPPSSSSSVKPSDAPTPTPRPDSHGFDGKTSAATQRPSTTNSTAEST
VSSSSEAHPTATGAPIGDPKFINATIPAGQLPLPPELTPGWGVAGVIMLTTGMTYALVGIKNRWIHTFFSTSYIT
ALGVAVLIIYVMNVPVSHAVQGGYVVAVIVSGCAVGGASMFFKELTEGLGCALGGFCLSMWLLCLVPGGMLRTVP
AKAIFNASFTLVGFALYFSRWTRDWTLIFTLAFSGATVTVLGLDCFSRAGLKEFWAYVWDVNNNLFPIGADTYPV
TKGIRVETAAIVIICIMGIISQIKLWRIVRDKRAKRAVERAEDRRNLDLEEENVGRQVEEANARDRRHWEQVYGN
DTVVGTDSRMSDLGDMTSEKKMPDGSYKQRSSVEVIEMADMSESDQSRAAKNPLMTAAEDAEDGKVMVLVGSDDH
HQDDDGAGAEKRVLERSSASKRASMAPEVVPLPFSVPPAPAPDADQGSEGDRSSIATYAADDAEKPLAANGNNGS
GVERASLAKRSFDLLKGRVSPRGGAEEAGPEAGHGSEQQLVGKTRRHDDDDGSLAATVDEASSSECNEGRRSSVC
NEDVVAELPGEEARSQGPASDGGKKPRKVSGPGGGADVYPAVPPSETPKSIASVVSTSANLTKDRLPHRMSRVAM
SYRTNEWAKHLGYAETPDPDELHLSSRSDAVTAAAAPAAAIEPSVPVDVVELQKTAEDGAPAPAVIRSDSRASDR
SYAPSVSRRASRRGAASPTLVTPEKEVISPGRVRSPGVPTASPPPRRPSSKFQERAAIPEEDTAPPSIDTVQRNS
LPVPGMVSYINPQTLMGQREMFLRSKSQGSLFGVAATQDQTTNDNGSPYGGASPVPGGHDAGEVPLSQRKDFVRQ
SSVVNLGQASSSYTMLPALASSESVENLAFNSHQPKRSLLTSSPAAREAQLANFRHSVQQDLRSGSPIMSAPVRE
TVFTPVSLGSRESEVQRNIEMQRNVLMGQKEAEAQRKEAYRREREFADRVFDERMRSGDLLEAHREAMRKMQKGA
RD*
Coding >Ophun1|4464
ATGCTGCCCAAGGCGGCCCGTCTGACGGCTCTGCTCACCTTGCTGCTCTTGACGCTGCACCTGGTCGCCGCTCAG
AACCCGCCGCCGCCGCCGTCATCATCATCGTCCGTCAAGCCGTCCGATGCTCCGACGCCAACTCCGCGTCCCGAC
TCTCACGGCTTCGATGGGAAAACTTCCGCTGCTACCCAAAGACCCTCCACCACCAACTCTACGGCCGAGTCAACC
GTCTCATCCTCTTCCGAAGCCCATCCCACCGCCACAGGGGCTCCCATTGGGGACCCCAAGTTCATCAATGCCACG
ATCCCTGCTGGTCAGCTTCCGCTCCCGCCGGAGCTCACTCCGGGCTGGGGCGTTGCCGGCGTCATCATGCTCACC
ACGGGCATGACCTATGCCCTCGTCGGCATCAAGAACCGATGGATCCACACCTTCTTTTCCACATCGTACATCACC
GCTCTCGGCGTTGCCGTCCTCATCATATACGTCATGAACGTACCCGTCAGCCACGCCGTCCAGGGAGGATACGTC
GTGGCCGTCATCGTCTCGGGCTGTGCCGTCGGCGGCGCCTCCATGTTCTTCAAGGAGCTGACGGAAGGTCTGGGT
TGCGCTCTCGGCGGCTTCTGTCTCAGCATGTGGCTGCTCTGTCTGGTGCCCGGCGGCATGCTCCGCACCGTCCCA
GCAAAGGCCATCTTCAACGCCTCCTTCACCCTCGTCGGCTTCGCCCTGTACTTTAGCCGCTGGACTCGGGACTGG
ACCCTCATCTTTACCCTCGCCTTCTCCGGCGCCACCGTCACCGTTCTCGGTCTCGACTGCTTCAGCCGCGCCGGC
CTCAAGGAGTTTTGGGCCTACGTCTGGGATGTCAACAATAACCTGTTTCCCATAGGCGCCGACACTTACCCGGTG
ACAAAGGGGATCCGTGTCGAGACGGCCGCCATTGTCATCATCTGCATCATGGGAATCATCTCTCAGATCAAGCTG
TGGAGGATCGTGCGAGACAAGCGGGCCAAGCGGGCAGTGGAGCGCGCCGAGGACCGGCGTAATCTCGATCTCGAA
GAGGAAAACGTCGGCCGTCAGGTCGAGGAGGCCAATGCCCGCGATCGTCGTCATTGGGAGCAGGTCTACGGCAAC
GACACCGTCGTCGGCACCGACTCGCGCATGTCGGACCTGGGCGACATGACGAGCGAGAAAAAGATGCCCGACGGT
TCTTACAAGCAGCGCTCCTCGGTCGAGGTAATTGAGATGGCCGACATGTCCGAGTCTGATCAGTCGAGGGCGGCC
AAGAACCCGCTCATGACGGCTGCCGAGGACGCCGAGGACGGCAAGGTCATGGTTCTCGTCGGCTCCGACGACCAC
CATCAGGACGACGACGGAGCCGGTGCCGAGAAGCGCGTCTTGGAGCGGTCCTCGGCCAGCAAGAGAGCCTCCATG
GCGCCCGAGGTGGTGCCTCTCCCGTTCAGCGTGCCCCCGGCGCCGGCGCCCGACGCCGATCAGGGGTCCGAGGGC
GACCGGTCGTCGATTGCTACGTATGCCGCCGACGACGCCGAGAAGCCGCTGGCCGCCAACGGAAACAACGGCAGC
GGCGTGGAACGGGCCTCGCTGGCCAAGCGCTCCTTTGACCTTCTCAAGGGCCGCGTCTCGCCGCGCGGAGGAGCC
GAAGAGGCCGGTCCGGAGGCGGGTCATGGCTCGGAGCAGCAGCTCGTCGGCAAGACTCGCCGGCACGACGACGAC
GACGGATCTCTGGCGGCCACCGTCGACGAAGCCAGCTCTAGTGAGTGTAACGAGGGGCGGCGCTCCTCCGTCTGC
AACGAGGACGTCGTGGCCGAGCTTCCGGGAGAGGAGGCGCGGTCTCAGGGGCCGGCGTCGGACGGCGGAAAGAAG
CCACGGAAGGTATCGGGGCCCGGAGGCGGCGCCGATGTCTATCCGGCCGTTCCCCCGTCCGAGACGCCCAAGTCG
ATTGCGTCGGTCGTCTCGACGTCGGCTAATCTGACCAAAGACCGTCTTCCGCACCGCATGTCGCGCGTCGCCATG
TCGTACCGCACCAACGAATGGGCCAAGCATCTCGGGTATGCCGAGACACCCGACCCGGATGAGCTGCACCTCTCC
AGCCGGTCGGATGCTGTGACGGCGGCTGCTGCTCCTGCGGCGGCCATTGAGCCGTCGGTGCCCGTCGATGTGGTG
GAACTGCAGAAGACGGCCGAGGACGGGGCGCCGGCGCCGGCGGTGATTCGGTCGGATTCTCGGGCCTCGGACAGG
TCGTACGCGCCCAGCGTCTCTCGTCGTGCCTCCCGAAGGGGCGCAGCCTCGCCCACGCTGGTGACGCCGGAAAAG
GAGGTGATATCGCCGGGCCGGGTTCGGAGTCCGGGCGTACCGACGGCGTCTCCGCCTCCGCGCCGGCCGTCGTCC
AAGTTCCAGGAACGAGCGGCGATCCCCGAGGAGGACACGGCGCCCCCGTCGATAGACACGGTTCAGCGAAACTCG
CTCCCCGTCCCGGGCATGGTGTCGTACATCAACCCGCAGACGCTCATGGGCCAGCGCGAGATGTTCCTCCGGAGC
AAGTCACAGGGGAGCCTGTTCGGAGTCGCCGCCACTCAAGACCAAACTACAAACGACAACGGCTCTCCGTACGGT
GGCGCGTCGCCGGTTCCGGGCGGCCACGACGCGGGCGAGGTACCGCTCAGCCAGCGCAAGGACTTTGTGCGTCAG
AGCAGCGTCGTCAACCTCGGCCAGGCTTCGTCGTCGTACACGATGCTACCGGCCCTGGCGTCGTCGGAGAGCGTG
GAGAACCTGGCCTTCAACTCGCATCAACCGAAGCGGTCGCTGCTGACGTCGTCTCCGGCGGCACGCGAGGCCCAG
CTGGCCAACTTCCGGCACTCTGTGCAGCAGGACCTCCGATCGGGCTCGCCCATCATGTCGGCGCCTGTGCGAGAG
ACGGTCTTTACGCCCGTCTCGCTCGGCAGCCGCGAGAGCGAGGTGCAGCGCAACATTGAGATGCAGCGCAACGTC
CTCATGGGTCAGAAGGAGGCCGAGGCTCAGCGGAAGGAGGCGTACCGACGGGAGAGGGAGTTTGCCGATCGGGTG
TTTGATGAGCGGATGCGGTCTGGGGACCTGCTTGAGGCTCATCGGGAGGCGATGCGCAAGATGCAAAAGGGGGCT
CGTGATTGA
Transcript >Ophun1|4464
ATGCTGCCCAAGGCGGCCCGTCTGACGGCTCTGCTCACCTTGCTGCTCTTGACGCTGCACCTGGTCGCCGCTCAG
AACCCGCCGCCGCCGCCGTCATCATCATCGTCCGTCAAGCCGTCCGATGCTCCGACGCCAACTCCGCGTCCCGAC
TCTCACGGCTTCGATGGGAAAACTTCCGCTGCTACCCAAAGACCCTCCACCACCAACTCTACGGCCGAGTCAACC
GTCTCATCCTCTTCCGAAGCCCATCCCACCGCCACAGGGGCTCCCATTGGGGACCCCAAGTTCATCAATGCCACG
ATCCCTGCTGGTCAGCTTCCGCTCCCGCCGGAGCTCACTCCGGGCTGGGGCGTTGCCGGCGTCATCATGCTCACC
ACGGGCATGACCTATGCCCTCGTCGGCATCAAGAACCGATGGATCCACACCTTCTTTTCCACATCGTACATCACC
GCTCTCGGCGTTGCCGTCCTCATCATATACGTCATGAACGTACCCGTCAGCCACGCCGTCCAGGGAGGATACGTC
GTGGCCGTCATCGTCTCGGGCTGTGCCGTCGGCGGCGCCTCCATGTTCTTCAAGGAGCTGACGGAAGGTCTGGGT
TGCGCTCTCGGCGGCTTCTGTCTCAGCATGTGGCTGCTCTGTCTGGTGCCCGGCGGCATGCTCCGCACCGTCCCA
GCAAAGGCCATCTTCAACGCCTCCTTCACCCTCGTCGGCTTCGCCCTGTACTTTAGCCGCTGGACTCGGGACTGG
ACCCTCATCTTTACCCTCGCCTTCTCCGGCGCCACCGTCACCGTTCTCGGTCTCGACTGCTTCAGCCGCGCCGGC
CTCAAGGAGTTTTGGGCCTACGTCTGGGATGTCAACAATAACCTGTTTCCCATAGGCGCCGACACTTACCCGGTG
ACAAAGGGGATCCGTGTCGAGACGGCCGCCATTGTCATCATCTGCATCATGGGAATCATCTCTCAGATCAAGCTG
TGGAGGATCGTGCGAGACAAGCGGGCCAAGCGGGCAGTGGAGCGCGCCGAGGACCGGCGTAATCTCGATCTCGAA
GAGGAAAACGTCGGCCGTCAGGTCGAGGAGGCCAATGCCCGCGATCGTCGTCATTGGGAGCAGGTCTACGGCAAC
GACACCGTCGTCGGCACCGACTCGCGCATGTCGGACCTGGGCGACATGACGAGCGAGAAAAAGATGCCCGACGGT
TCTTACAAGCAGCGCTCCTCGGTCGAGGTAATTGAGATGGCCGACATGTCCGAGTCTGATCAGTCGAGGGCGGCC
AAGAACCCGCTCATGACGGCTGCCGAGGACGCCGAGGACGGCAAGGTCATGGTTCTCGTCGGCTCCGACGACCAC
CATCAGGACGACGACGGAGCCGGTGCCGAGAAGCGCGTCTTGGAGCGGTCCTCGGCCAGCAAGAGAGCCTCCATG
GCGCCCGAGGTGGTGCCTCTCCCGTTCAGCGTGCCCCCGGCGCCGGCGCCCGACGCCGATCAGGGGTCCGAGGGC
GACCGGTCGTCGATTGCTACGTATGCCGCCGACGACGCCGAGAAGCCGCTGGCCGCCAACGGAAACAACGGCAGC
GGCGTGGAACGGGCCTCGCTGGCCAAGCGCTCCTTTGACCTTCTCAAGGGCCGCGTCTCGCCGCGCGGAGGAGCC
GAAGAGGCCGGTCCGGAGGCGGGTCATGGCTCGGAGCAGCAGCTCGTCGGCAAGACTCGCCGGCACGACGACGAC
GACGGATCTCTGGCGGCCACCGTCGACGAAGCCAGCTCTAGTGAGTGTAACGAGGGGCGGCGCTCCTCCGTCTGC
AACGAGGACGTCGTGGCCGAGCTTCCGGGAGAGGAGGCGCGGTCTCAGGGGCCGGCGTCGGACGGCGGAAAGAAG
CCACGGAAGGTATCGGGGCCCGGAGGCGGCGCCGATGTCTATCCGGCCGTTCCCCCGTCCGAGACGCCCAAGTCG
ATTGCGTCGGTCGTCTCGACGTCGGCTAATCTGACCAAAGACCGTCTTCCGCACCGCATGTCGCGCGTCGCCATG
TCGTACCGCACCAACGAATGGGCCAAGCATCTCGGGTATGCCGAGACACCCGACCCGGATGAGCTGCACCTCTCC
AGCCGGTCGGATGCTGTGACGGCGGCTGCTGCTCCTGCGGCGGCCATTGAGCCGTCGGTGCCCGTCGATGTGGTG
GAACTGCAGAAGACGGCCGAGGACGGGGCGCCGGCGCCGGCGGTGATTCGGTCGGATTCTCGGGCCTCGGACAGG
TCGTACGCGCCCAGCGTCTCTCGTCGTGCCTCCCGAAGGGGCGCAGCCTCGCCCACGCTGGTGACGCCGGAAAAG
GAGGTGATATCGCCGGGCCGGGTTCGGAGTCCGGGCGTACCGACGGCGTCTCCGCCTCCGCGCCGGCCGTCGTCC
AAGTTCCAGGAACGAGCGGCGATCCCCGAGGAGGACACGGCGCCCCCGTCGATAGACACGGTTCAGCGAAACTCG
CTCCCCGTCCCGGGCATGGTGTCGTACATCAACCCGCAGACGCTCATGGGCCAGCGCGAGATGTTCCTCCGGAGC
AAGTCACAGGGGAGCCTGTTCGGAGTCGCCGCCACTCAAGACCAAACTACAAACGACAACGGCTCTCCGTACGGT
GGCGCGTCGCCGGTTCCGGGCGGCCACGACGCGGGCGAGGTACCGCTCAGCCAGCGCAAGGACTTTGTGCGTCAG
AGCAGCGTCGTCAACCTCGGCCAGGCTTCGTCGTCGTACACGATGCTACCGGCCCTGGCGTCGTCGGAGAGCGTG
GAGAACCTGGCCTTCAACTCGCATCAACCGAAGCGGTCGCTGCTGACGTCGTCTCCGGCGGCACGCGAGGCCCAG
CTGGCCAACTTCCGGCACTCTGTGCAGCAGGACCTCCGATCGGGCTCGCCCATCATGTCGGCGCCTGTGCGAGAG
ACGGTCTTTACGCCCGTCTCGCTCGGCAGCCGCGAGAGCGAGGTGCAGCGCAACATTGAGATGCAGCGCAACGTC
CTCATGGGTCAGAAGGAGGCCGAGGCTCAGCGGAAGGAGGCGTACCGACGGGAGAGGGAGTTTGCCGATCGGGTG
TTTGATGAGCGGATGCGGTCTGGGGACCTGCTTGAGGCTCATCGGGAGGCGATGCGCAAGATGCAAAAGGGGGCT
CGTGATTGA
Gene >Ophun1|4464
ATGCTGCCCAAGGCGGCCCGTCTGACGGCTCTGCTCACCTTGCTGCTCTTGACGCTGCACCTGGTCGCCGCTCAG
AACCCGCCGCCGCCGCCGTCATCATCATCGTCCGTCAAGCCGTCCGATGCTCCGACGCCAACTCCGCGTCCCGAC
TCTCACGGCTTCGATGGGAAAACTTCCGGTATCTCATGGCCCCCCCCTGAACGCCTCTCCCGCCTCCCACCTCTC
GTCTCCGTCACTGATGCCCGGTCCCATGCAGCTGCTACCCAAAGACCCTCCACCACCAACTCTACGGCCGAGTCA
ACCGTCTCATCCTCTTCCGAAGCCCATCCCACCGCCACAGGGGCTCCCATTGGGGACCCCAAGTTCATCAATGGT
ATAATCCTCTGCCCCCCCTTTTGCTCCTTTCCCCCCCTTTTCCCCTCCCTGACATCGTCTCTTCCGCACAGCCAC
GATCCCTGCTGGTCAGCTTCCGCTCCCGCCGGAGCTCACTCCGGGCTGGGGCGTTGCCGGCGTCATCATGCTCAC
CACGGGCATGACCTATGCCCTCGTCGGCATCAAGAACCGATGGATCCACACCTTCTTTTCCACATCGTACATCAC
CGCTCTCGGCGTTGCCGTCCTCATCATATACGTCATGAACGTACCCGTCAGCCACGCCGTCCAGGGAGGATACGT
CGTGGCCGTCATCGTCTCGGGCTGTGCCGTCGGCGGCGCCTCCATGTTCTTCAAGGAGCTGACGGAAGGTCTGGG
TTGCGCTCTCGGCGGCTTCTGTCTCAGCATGTGGCTGCTCTGTCTGGTGCCCGGCGGCATGCTCCGCACCGTCCC
AGCAAAGGCCATCTTCAACGCCTCCTTCACCCTCGTCGGCTTCGCCCTGTACTTTAGCCGCTGGACTCGGGACTG
GACCCTCATCTTTACCCTCGCCTTCTCCGGCGCCACCGTCACCGTTCTCGGTCTCGACTGCTTCAGCCGCGCCGG
CCTCAAGGAGTTTTGGGCCTACGTCTGGGATGTCAACAATAACCTGTTTCCCATAGGCGCCGACACTTACCCGGT
GACAAAGGGGATCCGTGTCGAGACGGCCGCCATTGTCATCATCTGCATCATGGGAATCATCTCTCAGATCAAGCT
GTGGAGGATCGTGCGAGACAAGCGGGCCAAGCGGGCAGTGGAGCGCGCCGAGGACCGGCGTAATCTCGATCTCGA
AGAGGAAAACGTCGGCCGTCAGGTCGAGGAGGCCAATGCCCGCGATCGTCGTCATTGGGAGCAGGTCTACGGCAA
CGACACCGTCGTCGGCACCGACTCGCGCATGTCGGACCTGGGCGACATGACGAGCGAGAAAAAGATGCCCGACGG
TTCTTACAAGCAGCGCTCCTCGGTCGAGGTAATTGAGATGGCCGACATGTCCGAGTCTGATCAGTCGAGGGCGGC
CAAGAACCCGCTCATGACGGCTGCCGAGGACGCCGAGGACGGCAAGGTCATGGTTCTCGTCGGCTCCGACGACCA
CCATCAGGACGACGACGGAGCCGGTGCCGAGAAGCGCGTCTTGGAGCGGTCCTCGGCCAGCAAGAGAGCCTCCAT
GGCGCCCGAGGTGGTGCCTCTCCCGTTCAGCGTGCCCCCGGCGCCGGCGCCCGACGCCGATCAGGGGTCCGAGGG
CGACCGGTCGTCGATTGCTACGTATGCCGCCGACGACGCCGAGAAGCCGCTGGCCGCCAACGGAAACAACGGCAG
CGGCGTGGAACGGGCCTCGCTGGCCAAGCGCTCCTTTGACCTTCTCAAGGGCCGCGTCTCGCCGCGCGGAGGAGC
CGAAGAGGCCGGTCCGGAGGCGGGTCATGGCTCGGAGCAGCAGCTCGTCGGCAAGACTCGCCGGCACGACGACGA
CGACGGATCTCTGGCGGCCACCGTCGACGAAGCCAGCTCTAGTGAGTGTAACGAGGGGCGGCGCTCCTCCGTCTG
CAACGAGGACGTCGTGGCCGAGCTTCCGGGAGAGGAGGCGCGGTCTCAGGGGCCGGCGTCGGACGGCGGAAAGAA
GCCACGGAAGGTATCGGGGCCCGGAGGCGGCGCCGATGTCTATCCGGCCGTTCCCCCGTCCGAGACGCCCAAGTC
GATTGCGTCGGTCGTCTCGACGTCGGCTAATCTGACCAAAGACCGTCTTCCGCACCGCATGTCGCGCGTCGCCAT
GTCGTACCGCACCAACGAATGGGCCAAGCATCTCGGGTATGCCGAGACACCCGACCCGGATGAGCTGCACCTCTC
CAGCCGGTCGGATGCTGTGACGGCGGCTGCTGCTCCTGCGGCGGCCATTGAGCCGTCGGTGCCCGTCGATGTGGT
GGAACTGCAGAAGACGGCCGAGGACGGGGCGCCGGCGCCGGCGGTGATTCGGTCGGATTCTCGGGCCTCGGACAG
GTCGTACGCGCCCAGCGTCTCTCGTCGTGCCTCCCGAAGGGGCGCAGCCTCGCCCACGCTGGTGACGCCGGAAAA
GGAGGTGATATCGCCGGGCCGGGTTCGGAGTCCGGGCGTACCGACGGCGTCTCCGCCTCCGCGCCGGCCGTCGTC
CAAGTTCCAGGAACGAGCGGCGATCCCCGAGGAGGACACGGCGCCCCCGTCGATAGACACGGTTCAGCGAAACTC
GCTCCCCGTCCCGGGCATGGTGTCGTACATCAACCCGCAGACGCTCATGGGCCAGCGCGAGATGTTCCTCCGGAG
CAAGTCACAGGGGAGCCTGTTCGGAGTCGCCGCCACTCAAGACCAAACTACAAACGACAACGGCTCTCCGTACGG
TGGCGCGTCGCCGGTTCCGGGCGGCCACGACGCGGGCGAGGTACCGCTCAGCCAGCGCAAGGACTTTGTGCGTCA
GAGCAGCGTCGTCAACCTCGGCCAGGCTTCGTCGTCGTACACGATGCTACCGGCCCTGGCGTCGTCGGAGAGCGT
GGAGAACCTGGCCTTCAACTCGCATCAACCGAAGCGGTCGCTGCTGACGTCGTCTCCGGCGGCACGCGAGGCCCA
GCTGGCCAACTTCCGGCACTCTGTGCAGCAGGACCTCCGATCGGGCTCGCCCATCATGTCGGCGCCTGTGCGAGA
GACGGTCTTTACGCCCGTCTCGCTCGGCAGCCGCGAGAGCGAGGTGCAGCGCAACATTGAGATGCAGCGCAACGT
CCTCATGGGTCAGAAGGAGGCCGAGGCTCAGCGGAAGGAGGCGTACCGACGGGAGAGGGAGTTTGCCGATCGGGT
GTTTGATGAGCGGATGCGGTCTGGGGACCTGCTTGAGGCTCATCGGGAGGCGATGCGCAAGATGCAAAAGGGGGC
TCGTGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail