Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4463
Gene name
LocationContig_410:8838..11754
Strand+
Gene length (bp)2916
Transcript length (bp)2805
Coding sequence length (bp)2805
Protein length (aa) 935

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02386 TrkH Cation transport protein 4.9E-138 416 805

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28584|TRK2_YEAST Low-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK2 PE=1 SV=1 6 801 2.0E-169
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 418 815 8.0E-139
sp|P47946|TRK1_SCHPO Potassium transport protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk1 PE=3 SV=2 416 809 4.0E-124
sp|Q10065|TRK2_SCHPO Potassium transport protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk2 PE=2 SV=1 416 820 2.0E-113
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 418 683 3.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28584|TRK2_YEAST Low-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK2 PE=1 SV=1 6 801 2.0E-169
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 418 815 8.0E-139
sp|P47946|TRK1_SCHPO Potassium transport protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk1 PE=3 SV=2 416 809 4.0E-124
sp|Q10065|TRK2_SCHPO Potassium transport protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk2 PE=2 SV=1 416 820 2.0E-113
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 418 683 3.0E-93
sp|Q54DA4|Y2412_DICDI Putative potassium transport protein DDB_G0292412 OS=Dictyostelium discoideum GN=DDB_G0292412 PE=2 SV=1 434 796 9.0E-38
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 689 815 1.0E-32
sp|P47946|TRK1_SCHPO Potassium transport protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk1 PE=3 SV=2 25 234 2.0E-25
sp|Q84TI7|HKT1_ARATH Sodium transporter HKT1 OS=Arabidopsis thaliana GN=HKT1 PE=1 SV=1 437 802 8.0E-23
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 29 203 2.0E-21
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 28 146 4.0E-21
sp|Q6H501|HKT6_ORYSJ Probable cation transporter HKT6 OS=Oryza sativa subsp. japonica GN=HKT6 PE=2 SV=1 437 756 2.0E-17
sp|Q0D9S3|HKT1_ORYSJ Cation transporter HKT1 OS=Oryza sativa subsp. japonica GN=HKT1 PE=1 SV=1 496 791 3.0E-17
sp|A2YGP9|HKT1_ORYSI Cation transporter HKT1 OS=Oryza sativa subsp. indica GN=HKT1 PE=1 SV=2 496 791 3.0E-17
sp|Q7XPF8|HKT4_ORYSJ Cation transporter HKT4 OS=Oryza sativa subsp. japonica GN=HKT4 PE=1 SV=2 484 786 3.0E-15
sp|Q93XI5|HKT2_ORYSI Cation transporter HKT2 OS=Oryza sativa subsp. indica GN=HKT2 PE=1 SV=1 496 791 9.0E-15
sp|Q10065|TRK2_SCHPO Potassium transport protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk2 PE=2 SV=1 24 128 2.0E-14
sp|Q8L481|HKT3_ORYSJ Probable cation transporter HKT3 OS=Oryza sativa subsp. japonica GN=HKT3 PE=2 SV=1 445 756 1.0E-13
sp|Q8L4K5|HKT9_ORYSJ Probable cation transporter HKT9 OS=Oryza sativa subsp. japonica GN=HKT9 PE=2 SV=1 446 784 4.0E-12
sp|Q7XPF7|HKT7_ORYSJ Probable cation transporter HKT7 OS=Oryza sativa subsp. japonica GN=HKT7 PE=2 SV=2 494 786 1.0E-11
sp|O87953|KTRB_VIBAL Ktr system potassium uptake protein B OS=Vibrio alginolyticus GN=ktrB PE=1 SV=1 495 784 1.0E-09
sp|A2WNZ9|HKT8_ORYSI Cation transporter HKT8 OS=Oryza sativa subsp. indica GN=HKT8 PE=2 SV=2 491 786 2.0E-08
sp|O31658|KTRD_BACSU Ktr system potassium uptake protein D OS=Bacillus subtilis (strain 168) GN=ktrD PE=3 SV=1 497 784 2.0E-08
sp|Q0JNB6|HKT8_ORYSJ Cation transporter HKT8 OS=Oryza sativa subsp. japonica GN=HKT8 PE=3 SV=1 491 786 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006812 cation transport Yes
GO:0008324 cation transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0022857 transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 92 114 22
3 455 477 22
4 527 549 22
5 585 607 22
6 647 669 22
7 713 735 22
8 755 777 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4463
MLEAARDYAWTQLKAIKPAFFSKKPHFNFITVHYFWIISATIIASIAIYASGRGRLSYIDALMFGSGANTQAGLN
PVDLNTLNGFQQAMIYIFSMISNPVTLNACVVFLRLYWFEKRFQTWVREIRSRRPTLSKSRSKSVADVEMVPPQR
HQGVNGRHITIVPQDGRSQRITNDGILLEGDRDVSPRSSDRVKSDGSDSSTVNDDKQTDPPGTDADAARPLVGAV
NDHAGAYAPGSPRAAQAGHMSISFANIVKRSDGMGEDALKVPQHRSNAEHIAILERQRNQDNEILRIPGPRDIER
GLGPRRLQDDDLQDDDDNALAKTRTTDSRMEQTSGDPTHIRGRQPTITIAEPSRPADRARTDGRAVDSLRFRHSG
RRTRHEGGGDDSRADPRSRGAVRRLSELRSALSLSREQEEMPYLSYTPTIARNSNFVGLTLDQREELGGIEYRSL
RTLAVILLLYFWGFQLIILSFLWPFILHNAFYGKVVQDARVSRTWWAFFTSNAAFMDVGFTLTPDSMISFQTSEY
VLIIMWFFIIIGNTGFPVMLRFLIWVAAKVTPRGSGLWEELRFLLDHPRRCFTLMFPSGPTWWLFWILIMLNVID
LVFFIVLDLHGEPIDKLSQGNRVVIGLFQAASTRTAGFSAVSLSDLHPAMPVLYMIMMYISVFPIAISIRRTNVY
EERSLGVYHDHVVEDDADSSALSYVGSHLRRQLSFDLWYVFLGFFILAITEGSKIQAHEFDLFAVLFEVVSAYGT
VGLSMGAAGINASLCSQFSVVGKLVIIAMQIRGRHRGLPYGLDRAVLLPSESRFRKEAEAADSDPGRSNSISAAA
MATGLQRQRTMPGVGRSMSRERERANSNLISQFLHPGPVVHRDTALPHARPRSIDSYPPSLSSPSVFAASLGPRT
QTEPVIETGASAEPPTPSSAFSHHKRTRSETSGF*
Coding >Ophun1|4463
ATGCTCGAAGCGGCTCGCGATTATGCCTGGACACAGCTCAAGGCTATCAAGCCTGCCTTCTTCTCCAAGAAGCCG
CACTTCAACTTCATTACCGTCCACTATTTCTGGATCATAAGCGCAACCATCATCGCATCCATCGCCATCTATGCT
TCGGGTAGAGGCAGACTTTCGTATATCGATGCTTTGATGTTTGGCAGCGGCGCCAACACGCAAGCCGGCCTCAAT
CCCGTCGATCTCAACACGCTCAATGGGTTCCAGCAGGCCATGATCTACATCTTTTCCATGATATCCAACCCAGTC
ACTCTCAATGCCTGCGTCGTCTTCCTCCGCCTCTATTGGTTCGAGAAGCGCTTCCAGACATGGGTCCGCGAAATC
CGCTCACGACGTCCGACCTTGTCCAAGTCTAGATCAAAGTCCGTGGCCGACGTCGAGATGGTCCCTCCCCAGCGA
CACCAGGGCGTCAACGGTCGACACATTACCATCGTACCGCAAGACGGTCGCTCGCAGAGAATCACAAACGACGGC
ATCCTCTTGGAGGGTGACAGGGACGTATCGCCCCGCTCCTCGGACAGGGTCAAGAGCGATGGGAGCGACTCGAGT
ACCGTCAACGACGACAAACAGACGGACCCCCCGGGGACCGATGCCGATGCGGCGCGGCCTCTGGTCGGTGCCGTA
AACGACCACGCCGGCGCATACGCTCCCGGGAGTCCCAGAGCCGCCCAGGCCGGTCACATGTCCATCTCGTTTGCC
AACATAGTCAAGAGGAGCGATGGCATGGGCGAGGATGCTCTCAAGGTTCCGCAGCATCGCTCCAACGCCGAACAC
ATCGCCATCCTCGAGCGGCAACGGAACCAGGATAACGAGATCCTGCGCATCCCGGGGCCTCGCGATATAGAGAGA
GGTCTTGGGCCTAGGAGGCTCCAGGACGACGATCTGCAGGATGACGACGACAATGCTCTCGCCAAGACGAGGACG
ACGGACTCGCGCATGGAGCAGACGTCCGGTGACCCGACGCACATCCGTGGACGCCAGCCGACCATTACCATTGCC
GAGCCCAGCCGCCCAGCGGACAGAGCTAGGACGGATGGCCGGGCCGTGGATTCGCTTCGTTTTCGGCATTCCGGC
CGGAGGACCCGTCACGAGGGCGGTGGCGACGACAGCAGGGCGGATCCTCGGTCCAGGGGCGCCGTGCGCAGGCTG
AGCGAATTACGATCGGCCCTGTCCCTGTCGAGGGAGCAGGAGGAGATGCCCTACCTGTCGTATACGCCGACCATC
GCCCGCAACTCCAACTTTGTCGGCCTGACGCTCGACCAGCGCGAAGAGCTCGGCGGCATCGAATACCGCTCCCTC
AGGACGCTCGCCGTCATTCTCCTGCTCTACTTTTGGGGCTTCCAGCTCATCATCCTCTCGTTCCTGTGGCCCTTT
ATCCTTCACAATGCCTTTTACGGCAAGGTGGTTCAGGATGCCCGAGTCAGCAGGACCTGGTGGGCCTTCTTCACG
TCCAACGCCGCCTTTATGGACGTCGGCTTCACCCTGACGCCGGACAGCATGATCTCGTTCCAGACTTCGGAATAC
GTCCTGATCATCATGTGGTTCTTCATCATCATCGGAAACACGGGCTTCCCGGTCATGCTTCGCTTCCTCATCTGG
GTCGCCGCCAAGGTGACGCCTCGAGGATCCGGCCTGTGGGAGGAACTGCGGTTCTTGCTGGATCACCCGCGTCGA
TGCTTTACGCTCATGTTTCCTTCGGGCCCTACCTGGTGGCTGTTTTGGATCCTCATCATGCTCAACGTCATCGAT
CTCGTCTTCTTCATCGTCCTCGACCTTCATGGAGAGCCGATTGATAAGCTTTCGCAAGGGAACCGCGTCGTCATC
GGTCTCTTCCAGGCGGCCTCGACGAGGACGGCGGGCTTCTCGGCCGTCAGTCTGAGCGACCTGCACCCGGCAATG
CCGGTGCTGTACATGATTATGATGTACATCTCCGTCTTTCCCATTGCCATCTCTATCCGGCGGACCAACGTCTAT
GAAGAGAGGTCACTGGGCGTCTATCACGACCACGTGGTTGAAGACGACGCGGATTCGAGCGCGCTGTCGTACGTC
GGCAGTCACTTGCGGCGGCAGCTGTCGTTTGATCTGTGGTACGTCTTTCTCGGCTTCTTCATCCTGGCCATCACC
GAGGGCAGCAAGATACAGGCGCACGAGTTTGATCTGTTTGCCGTACTGTTCGAGGTGGTCAGCGCCTACGGCACC
GTCGGCCTGAGCATGGGCGCGGCCGGCATCAACGCGTCTCTTTGCTCGCAGTTCTCCGTCGTCGGCAAGCTGGTC
ATCATCGCCATGCAGATCCGAGGCCGGCACCGAGGCCTCCCGTATGGCCTGGACCGCGCCGTGTTGCTGCCCAGC
GAGTCCCGGTTCCGGAAGGAGGCCGAGGCAGCCGACTCGGACCCGGGCCGCAGCAACAGCATCTCGGCGGCGGCG
ATGGCGACGGGACTGCAGCGGCAGAGGACGATGCCGGGAGTCGGGCGCAGCATGAGCCGCGAGAGAGAAAGGGCC
AATAGCAACCTGATATCGCAGTTCCTGCATCCGGGTCCGGTGGTTCATCGCGACACGGCGCTGCCGCACGCGAGG
CCGAGGTCCATCGACTCGTATCCGCCCTCTCTCAGCTCTCCCTCGGTGTTTGCGGCCTCGCTGGGACCGAGAACG
CAGACGGAGCCGGTGATTGAGACGGGGGCGTCTGCCGAGCCGCCGACTCCCAGCTCGGCTTTTTCGCACCACAAG
CGGACGAGGTCGGAGACGTCGGGGTTTTAG
Transcript >Ophun1|4463
ATGCTCGAAGCGGCTCGCGATTATGCCTGGACACAGCTCAAGGCTATCAAGCCTGCCTTCTTCTCCAAGAAGCCG
CACTTCAACTTCATTACCGTCCACTATTTCTGGATCATAAGCGCAACCATCATCGCATCCATCGCCATCTATGCT
TCGGGTAGAGGCAGACTTTCGTATATCGATGCTTTGATGTTTGGCAGCGGCGCCAACACGCAAGCCGGCCTCAAT
CCCGTCGATCTCAACACGCTCAATGGGTTCCAGCAGGCCATGATCTACATCTTTTCCATGATATCCAACCCAGTC
ACTCTCAATGCCTGCGTCGTCTTCCTCCGCCTCTATTGGTTCGAGAAGCGCTTCCAGACATGGGTCCGCGAAATC
CGCTCACGACGTCCGACCTTGTCCAAGTCTAGATCAAAGTCCGTGGCCGACGTCGAGATGGTCCCTCCCCAGCGA
CACCAGGGCGTCAACGGTCGACACATTACCATCGTACCGCAAGACGGTCGCTCGCAGAGAATCACAAACGACGGC
ATCCTCTTGGAGGGTGACAGGGACGTATCGCCCCGCTCCTCGGACAGGGTCAAGAGCGATGGGAGCGACTCGAGT
ACCGTCAACGACGACAAACAGACGGACCCCCCGGGGACCGATGCCGATGCGGCGCGGCCTCTGGTCGGTGCCGTA
AACGACCACGCCGGCGCATACGCTCCCGGGAGTCCCAGAGCCGCCCAGGCCGGTCACATGTCCATCTCGTTTGCC
AACATAGTCAAGAGGAGCGATGGCATGGGCGAGGATGCTCTCAAGGTTCCGCAGCATCGCTCCAACGCCGAACAC
ATCGCCATCCTCGAGCGGCAACGGAACCAGGATAACGAGATCCTGCGCATCCCGGGGCCTCGCGATATAGAGAGA
GGTCTTGGGCCTAGGAGGCTCCAGGACGACGATCTGCAGGATGACGACGACAATGCTCTCGCCAAGACGAGGACG
ACGGACTCGCGCATGGAGCAGACGTCCGGTGACCCGACGCACATCCGTGGACGCCAGCCGACCATTACCATTGCC
GAGCCCAGCCGCCCAGCGGACAGAGCTAGGACGGATGGCCGGGCCGTGGATTCGCTTCGTTTTCGGCATTCCGGC
CGGAGGACCCGTCACGAGGGCGGTGGCGACGACAGCAGGGCGGATCCTCGGTCCAGGGGCGCCGTGCGCAGGCTG
AGCGAATTACGATCGGCCCTGTCCCTGTCGAGGGAGCAGGAGGAGATGCCCTACCTGTCGTATACGCCGACCATC
GCCCGCAACTCCAACTTTGTCGGCCTGACGCTCGACCAGCGCGAAGAGCTCGGCGGCATCGAATACCGCTCCCTC
AGGACGCTCGCCGTCATTCTCCTGCTCTACTTTTGGGGCTTCCAGCTCATCATCCTCTCGTTCCTGTGGCCCTTT
ATCCTTCACAATGCCTTTTACGGCAAGGTGGTTCAGGATGCCCGAGTCAGCAGGACCTGGTGGGCCTTCTTCACG
TCCAACGCCGCCTTTATGGACGTCGGCTTCACCCTGACGCCGGACAGCATGATCTCGTTCCAGACTTCGGAATAC
GTCCTGATCATCATGTGGTTCTTCATCATCATCGGAAACACGGGCTTCCCGGTCATGCTTCGCTTCCTCATCTGG
GTCGCCGCCAAGGTGACGCCTCGAGGATCCGGCCTGTGGGAGGAACTGCGGTTCTTGCTGGATCACCCGCGTCGA
TGCTTTACGCTCATGTTTCCTTCGGGCCCTACCTGGTGGCTGTTTTGGATCCTCATCATGCTCAACGTCATCGAT
CTCGTCTTCTTCATCGTCCTCGACCTTCATGGAGAGCCGATTGATAAGCTTTCGCAAGGGAACCGCGTCGTCATC
GGTCTCTTCCAGGCGGCCTCGACGAGGACGGCGGGCTTCTCGGCCGTCAGTCTGAGCGACCTGCACCCGGCAATG
CCGGTGCTGTACATGATTATGATGTACATCTCCGTCTTTCCCATTGCCATCTCTATCCGGCGGACCAACGTCTAT
GAAGAGAGGTCACTGGGCGTCTATCACGACCACGTGGTTGAAGACGACGCGGATTCGAGCGCGCTGTCGTACGTC
GGCAGTCACTTGCGGCGGCAGCTGTCGTTTGATCTGTGGTACGTCTTTCTCGGCTTCTTCATCCTGGCCATCACC
GAGGGCAGCAAGATACAGGCGCACGAGTTTGATCTGTTTGCCGTACTGTTCGAGGTGGTCAGCGCCTACGGCACC
GTCGGCCTGAGCATGGGCGCGGCCGGCATCAACGCGTCTCTTTGCTCGCAGTTCTCCGTCGTCGGCAAGCTGGTC
ATCATCGCCATGCAGATCCGAGGCCGGCACCGAGGCCTCCCGTATGGCCTGGACCGCGCCGTGTTGCTGCCCAGC
GAGTCCCGGTTCCGGAAGGAGGCCGAGGCAGCCGACTCGGACCCGGGCCGCAGCAACAGCATCTCGGCGGCGGCG
ATGGCGACGGGACTGCAGCGGCAGAGGACGATGCCGGGAGTCGGGCGCAGCATGAGCCGCGAGAGAGAAAGGGCC
AATAGCAACCTGATATCGCAGTTCCTGCATCCGGGTCCGGTGGTTCATCGCGACACGGCGCTGCCGCACGCGAGG
CCGAGGTCCATCGACTCGTATCCGCCCTCTCTCAGCTCTCCCTCGGTGTTTGCGGCCTCGCTGGGACCGAGAACG
CAGACGGAGCCGGTGATTGAGACGGGGGCGTCTGCCGAGCCGCCGACTCCCAGCTCGGCTTTTTCGCACCACAAG
CGGACGAGGTCGGAGACGTCGGGGTTTTAG
Gene >Ophun1|4463
ATGCTCGAAGCGGCTCGCGATTATGCCTGGACACAGCTCAAGGCTATCAAGCCTGCCTTCTTCTCCAAGAAGCCG
CACTTCAACTTCATTACCGTCCACTGTTTGTCACCTCCCCTGTCATGGCCCCCAATCGTGAGAGCTGACCATTGG
TCCCAGATTTCTGGATCATAAGCGCAACCATCATCGCATCCATCGCCATCTATGCTTCGGGTAGAGGCAGACTTT
CGTATATCGATGCTTTGATGTTTGGCAGCGGCGCCAACACGCAAGCCGGCCTCAATCCCGTCGATCTCAACACGC
TCAATGGGTTCCAGCAGGCCATGATCTACATCTTTTCCATGATATCCAACCCAGTCACTCTCAATGCCTGCGTCG
TCTTCCTCCGCCTCTATTGGTTCGAGAAGCGCTTCCAGACATGGGTCCGCGAAATCCGCTCACGACGTCCGACCT
TGTCCAAGTCTAGATCAAAGTCCGTGGCCGACGTCGAGATGGTCCCTCCCCAGCGACACCAGGGCGTCAACGGTC
GACACATTACCATCGTACCGCAAGACGGTCGCTCGCAGAGAATCACAAACGACGGCATCCTCTTGGAGGGTGACA
GGGACGTATCGCCCCGCTCCTCGGACAGGGTCAAGAGCGATGGGAGCGACTCGAGTACCGTCAACGACGACAAAC
AGACGGACCCCCCGGGGACCGATGCCGATGCGGCGCGGCCTCTGGTCGGTGCCGTAAACGACCACGCCGGCGCAT
ACGCTCCCGGGAGTCCCAGAGCCGCCCAGGCCGGTCACATGTCCATCTCGTTTGCCAACATAGTCAAGAGGAGCG
ATGGCATGGGCGAGGATGCTCTCAAGGTTCCGCAGCATCGCTCCAACGCCGAACACATCGCCATCCTCGAGCGGC
AACGGAACCAGGATAACGAGATCCTGCGCATCCCGGGGCCTCGCGATATAGAGAGAGGTCTTGGGCCTAGGAGGC
TCCAGGACGACGATCTGCAGGATGACGACGACAATGCTCTCGCCAAGACGAGGACGACGGACTCGCGCATGGAGC
AGACGTCCGGTGACCCGACGCACATCCGTGGACGCCAGCCGACCATTACCATTGCCGAGCCCAGCCGCCCAGCGG
ACAGAGCTAGGACGGATGGCCGGGCCGTGGATTCGCTTCGTTTTCGGCATTCCGGCCGGAGGACCCGTCACGAGG
GCGGTGGCGACGACAGCAGGGCGGATCCTCGGTCCAGGGGCGCCGTGCGCAGGCTGAGCGAATTACGATCGGCCC
TGTCCCTGTCGAGGGAGCAGGAGGAGATGCCCTACCTGTCGTATACGCCGACCATCGCCCGCAACTCCAACTTTG
TCGGCCTGACGCTCGACCAGCGCGAAGAGCTCGGCGGCATCGAATACCGCTCCCTCAGGACGCTCGCCGTCATTC
TCCTGCTCTACTTTTGGGGCTTCCAGCTCATCATCCTCTCGTTCCTGTGGCCCTTTATCCTTCACAATGCCTTTT
ACGGCAAGGTGGTTCAGGATGCCCGAGTCAGCAGGACCTGGTGGGCCTTCTTCACGTCCAACGCCGCCTTTATGG
ACGTCGGCTTCACCCTGACGCCGGACAGCATGATCTCGTTCCAGACTTCGGAATACGTCCTGATCATCATGTGGT
TCTTCATCATCATCGGAAACACGGGCTTCCCGGTCATGCTTCGCTTCCTCATCTGGGTCGCCGCCAAGGTGACGC
CTCGAGGATCCGGCCTGTGGGAGGAACTGCGGTTCTTGCTGGATCACCCGCGTCGATGCTTTACGCTCATGTTTC
CTTCGGGCCCTACCTGGTGGCTGTTTTGGATCCTCATCATGCTCAACGTCATCGATCTCGTCTTCTTCATCGTCC
TCGACGTGCGTCTCTCCATGCTGTTGTCGTTGCGTGCCTGCTGACTCGCTTCCCTTGCAGCTTCATGGAGAGCCG
ATTGATAAGCTTTCGCAAGGGAACCGCGTCGTCATCGGTCTCTTCCAGGCGGCCTCGACGAGGACGGCGGGCTTC
TCGGCCGTCAGTCTGAGCGACCTGCACCCGGCAATGCCGGTGCTGTACATGATTATGATGTACATCTCCGTCTTT
CCCATTGCCATCTCTATCCGGCGGACCAACGTCTATGAAGAGAGGTCACTGGGCGTCTATCACGACCACGTGGTT
GAAGACGACGCGGATTCGAGCGCGCTGTCGTACGTCGGCAGTCACTTGCGGCGGCAGCTGTCGTTTGATCTGTGG
TACGTCTTTCTCGGCTTCTTCATCCTGGCCATCACCGAGGGCAGCAAGATACAGGCGCACGAGTTTGATCTGTTT
GCCGTACTGTTCGAGGTGGTCAGCGCCTACGGCACCGTCGGCCTGAGCATGGGCGCGGCCGGCATCAACGCGTCT
CTTTGCTCGCAGTTCTCCGTCGTCGGCAAGCTGGTCATCATCGCCATGCAGATCCGAGGCCGGCACCGAGGCCTC
CCGTATGGCCTGGACCGCGCCGTGTTGCTGCCCAGCGAGTCCCGGTTCCGGAAGGAGGCCGAGGCAGCCGACTCG
GACCCGGGCCGCAGCAACAGCATCTCGGCGGCGGCGATGGCGACGGGACTGCAGCGGCAGAGGACGATGCCGGGA
GTCGGGCGCAGCATGAGCCGCGAGAGAGAAAGGGCCAATAGCAACCTGATATCGCAGTTCCTGCATCCGGGTCCG
GTGGTTCATCGCGACACGGCGCTGCCGCACGCGAGGCCGAGGTCCATCGACTCGTATCCGCCCTCTCTCAGCTCT
CCCTCGGTGTTTGCGGCCTCGCTGGGACCGAGAACGCAGACGGAGCCGGTGATTGAGACGGGGGCGTCTGCCGAG
CCGCCGACTCCCAGCTCGGCTTTTTCGCACCACAAGCGGACGAGGTCGGAGACGTCGGGGTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail