© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophun1|4447 |
| Gene name | |
| Location | Contig_41:27268..29336 |
| Strand | - |
| Gene length (bp) | 2068 |
| Transcript length (bp) | 1644 |
| Coding sequence length (bp) | 1644 |
| Protein length (aa) | 548 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00006 | ATP-synt_ab | ATP synthase alpha/beta family, nucleotide-binding domain | 3.0E-71 | 186 | 409 |
| PF00306 | ATP-synt_ab_C | ATP synthase alpha/beta chain, C terminal domain | 2.9E-47 | 416 | 541 |
| PF02874 | ATP-synt_ab_N | ATP synthase alpha/beta family, beta-barrel domain | 1.0E-11 | 72 | 129 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P37211|ATPA_NEUCR | ATP synthase subunit alpha, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp-1 PE=3 SV=1 | 1 | 547 | 0.0E+00 |
| sp|P49375|ATPA_KLULA | ATP synthase subunit alpha, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP1 PE=1 SV=1 | 1 | 545 | 0.0E+00 |
| sp|P07251|ATPA_YEAST | ATP synthase subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP1 PE=1 SV=5 | 39 | 545 | 0.0E+00 |
| sp|P24487|ATPA_SCHPO | ATP synthase subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp1 PE=3 SV=1 | 35 | 545 | 0.0E+00 |
| sp|Q5R546|ATPA_PONAB | ATP synthase subunit alpha, mitochondrial OS=Pongo abelii GN=ATP5A1 PE=2 SV=1 | 30 | 545 | 0.0E+00 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P37211|ATPA_NEUCR | ATP synthase subunit alpha, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp-1 PE=3 SV=1 | 1 | 547 | 0.0E+00 |
| sp|P49375|ATPA_KLULA | ATP synthase subunit alpha, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP1 PE=1 SV=1 | 1 | 545 | 0.0E+00 |
| sp|P07251|ATPA_YEAST | ATP synthase subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP1 PE=1 SV=5 | 39 | 545 | 0.0E+00 |
| sp|P24487|ATPA_SCHPO | ATP synthase subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp1 PE=3 SV=1 | 35 | 545 | 0.0E+00 |
| sp|Q5R546|ATPA_PONAB | ATP synthase subunit alpha, mitochondrial OS=Pongo abelii GN=ATP5A1 PE=2 SV=1 | 30 | 545 | 0.0E+00 |
| sp|P19483|ATPA_BOVIN | ATP synthase subunit alpha, mitochondrial OS=Bos taurus GN=ATP5A1 PE=1 SV=1 | 42 | 545 | 0.0E+00 |
| sp|A5A6H5|ATPA_PANTR | ATP synthase subunit alpha, mitochondrial OS=Pan troglodytes GN=ATP5A1 PE=2 SV=1 | 30 | 545 | 0.0E+00 |
| sp|P25705|ATPA_HUMAN | ATP synthase subunit alpha, mitochondrial OS=Homo sapiens GN=ATP5A1 PE=1 SV=1 | 30 | 545 | 0.0E+00 |
| sp|P80021|ATPA_PIG | ATP synthase subunit alpha, mitochondrial OS=Sus scrofa GN=ATP5A1 PE=1 SV=2 | 42 | 545 | 0.0E+00 |
| sp|Q03265|ATPA_MOUSE | ATP synthase subunit alpha, mitochondrial OS=Mus musculus GN=Atp5a1 PE=1 SV=1 | 42 | 545 | 0.0E+00 |
| sp|P15999|ATPA_RAT | ATP synthase subunit alpha, mitochondrial OS=Rattus norvegicus GN=Atp5a1 PE=1 SV=2 | 42 | 545 | 0.0E+00 |
| sp|Q9XXK1|ATPA_CAEEL | ATP synthase subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=H28O16.1 PE=1 SV=1 | 9 | 545 | 0.0E+00 |
| sp|P35381|ATPA_DROME | ATP synthase subunit alpha, mitochondrial OS=Drosophila melanogaster GN=blw PE=1 SV=2 | 47 | 547 | 0.0E+00 |
| sp|C3M9S3|ATPA_RHISN | ATP synthase subunit alpha OS=Rhizobium sp. (strain NGR234) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A5V3X3|ATPA_SPHWW | ATP synthase subunit alpha OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A6UDM3|ATPA_SINMW | ATP synthase subunit alpha OS=Sinorhizobium medicae (strain WSM419) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q92LK6|ATPA_RHIME | ATP synthase subunit alpha OS=Rhizobium meliloti (strain 1021) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|P08428|ATPA_XENLA | ATP synthase subunit alpha, mitochondrial OS=Xenopus laevis GN=atp5a PE=2 SV=1 | 42 | 545 | 0.0E+00 |
| sp|Q8UC74|ATPA_AGRFC | ATP synthase subunit alpha OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q4FP36|ATPA_PELUB | ATP synthase subunit alpha OS=Pelagibacter ubique (strain HTCC1062) GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|B9KPI6|ATPA_RHOSK | ATP synthase subunit alpha OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q3J433|ATPA_RHOS4 | ATP synthase subunit alpha OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A3PIB7|ATPA1_RHOS1 | ATP synthase subunit alpha 1 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=atpA1 PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q1MAZ0|ATPA_RHIL3 | ATP synthase subunit alpha OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q0BQE6|ATPA_GRABC | ATP synthase subunit alpha OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|Q2N8Z5|ATPA_ERYLH | ATP synthase subunit alpha OS=Erythrobacter litoralis (strain HTCC2594) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A7HT50|ATPA_PARL1 | ATP synthase subunit alpha OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A5VSE3|ATPA_BRUO2 | ATP synthase subunit alpha OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A4WUM9|ATPA_RHOS5 | ATP synthase subunit alpha OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q57B86|ATPA_BRUAB | ATP synthase subunit alpha OS=Brucella abortus biovar 1 (strain 9-941) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q2YLI5|ATPA_BRUA2 | ATP synthase subunit alpha OS=Brucella abortus (strain 2308) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|B2S7M5|ATPA_BRUA1 | ATP synthase subunit alpha OS=Brucella abortus (strain S19) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q1GEU6|ATPA_RUEST | ATP synthase subunit alpha OS=Ruegeria sp. (strain TM1040) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B5ZSN9|ATPA_RHILW | ATP synthase subunit alpha OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A9WWS4|ATPA_BRUSI | ATP synthase subunit alpha OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A9M839|ATPA_BRUC2 | ATP synthase subunit alpha OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q8YJ37|ATPA_BRUME | ATP synthase subunit alpha OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|C0RF52|ATPA_BRUMB | ATP synthase subunit alpha OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q8FYR3|ATPA_BRUSU | ATP synthase subunit alpha OS=Brucella suis biovar 1 (strain 1330) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q98EV6|ATPA_RHILO | ATP synthase subunit alpha OS=Rhizobium loti (strain MAFF303099) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q5LNN9|ATPA_RUEPO | ATP synthase subunit alpha OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A7IH29|ATPA_XANP2 | ATP synthase subunit alpha OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q2K3G8|ATPA_RHIEC | ATP synthase subunit alpha OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q11DD7|ATPA_CHESB | ATP synthase subunit alpha OS=Chelativorans sp. (strain BNC1) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q28TJ8|ATPA_JANSC | ATP synthase subunit alpha OS=Jannaschia sp. (strain CCS1) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B3PQ70|ATPA_RHIE6 | ATP synthase subunit alpha OS=Rhizobium etli (strain CIAT 652) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|P72245|ATPA_RHOCA | ATP synthase subunit alpha OS=Rhodobacter capsulatus GN=atpA PE=1 SV=3 | 47 | 545 | 0.0E+00 |
| sp|B0UE41|ATPA_METS4 | ATP synthase subunit alpha OS=Methylobacterium sp. (strain 4-46) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A8HS15|ATPA_AZOC5 | ATP synthase subunit alpha OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A6WXW9|ATPA_OCHA4 | ATP synthase subunit alpha OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B8IN03|ATPA_METNO | ATP synthase subunit alpha OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A1UR47|ATPA_BARBK | ATP synthase subunit alpha OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|B1ZEE9|ATPA_METPB | ATP synthase subunit alpha OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q2G5N7|ATPA_NOVAD | ATP synthase subunit alpha OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q2VZN0|ATPA_MAGSA | ATP synthase subunit alpha OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A5FZ52|ATPA_ACICJ | ATP synthase subunit alpha OS=Acidiphilium cryptum (strain JF-5) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|Q21CY5|ATPA_RHOPB | ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain BisB18) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A8LJR6|ATPA2_DINSH | ATP synthase subunit alpha 2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=atpA2 PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B9JTR4|ATPA_AGRVS | ATP synthase subunit alpha OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q9A2V7|ATPA_CAUCR | ATP synthase subunit alpha OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B8H5I2|ATPA_CAUCN | ATP synthase subunit alpha OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B0T338|ATPA_CAUSK | ATP synthase subunit alpha OS=Caulobacter sp. (strain K31) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B1LVH1|ATPA_METRJ | ATP synthase subunit alpha OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|P05439|ATPA_RHOBL | ATP synthase subunit alpha OS=Rhodobacter blasticus GN=atpA PE=3 SV=1 | 47 | 536 | 0.0E+00 |
| sp|Q162S7|ATPA_ROSDO | ATP synthase subunit alpha OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q13DP4|ATPA_RHOPS | ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain BisB5) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q2J3I2|ATPA_RHOP2 | ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain HaA2) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q0AKV8|ATPA_MARMM | ATP synthase subunit alpha OS=Maricaulis maris (strain MCS10) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q5NQZ1|ATPA_ZYMMO | ATP synthase subunit alpha OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B8EQP9|ATPA_METSB | ATP synthase subunit alpha OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A9W2R3|ATPA_METEP | ATP synthase subunit alpha OS=Methylobacterium extorquens (strain PA1) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B7KUA4|ATPA_METC4 | ATP synthase subunit alpha OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|P05036|ATPA_RHORU | ATP synthase subunit alpha OS=Rhodospirillum rubrum GN=atpA PE=1 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q2RV20|ATPA_RHORT | ATP synthase subunit alpha OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A9IYX0|ATPA_BART1 | ATP synthase subunit alpha OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|A5E948|ATPA_BRASB | ATP synthase subunit alpha OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q89X72|ATPA_BRADU | ATP synthase subunit alpha OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q6FYM1|ATPA_BARQU | ATP synthase subunit alpha OS=Bartonella quintana (strain Toulouse) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|A4YKD8|ATPA_BRASO | ATP synthase subunit alpha OS=Bradyrhizobium sp. (strain ORS278) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q6NDD0|ATPA_RHOPA | ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q1QQS5|ATPA_NITHX | ATP synthase subunit alpha OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A1B8N8|ATPA_PARDP | ATP synthase subunit alpha OS=Paracoccus denitrificans (strain Pd 1222) GN=atpA PE=1 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q6G1W7|ATPA_BARHE | ATP synthase subunit alpha OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|B6JD06|ATPA_OLICO | ATP synthase subunit alpha OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q07UZ3|ATPA_RHOP5 | ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain BisA53) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q1GQS7|ATPA_SPHAL | ATP synthase subunit alpha OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q3SVJ4|ATPA_NITWN | ATP synthase subunit alpha OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|P26854|ATPAM_MARPO | ATP synthase subunit alpha, mitochondrial OS=Marchantia polymorpha GN=ATPA PE=3 SV=2 | 47 | 546 | 0.0E+00 |
| sp|A9H9A4|ATPA_GLUDA | ATP synthase subunit alpha OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=atpA PE=3 SV=1 | 45 | 547 | 0.0E+00 |
| sp|B4RD45|ATPA_PHEZH | ATP synthase subunit alpha OS=Phenylobacterium zucineum (strain HLK1) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A0LDA2|ATPA_MAGMM | ATP synthase subunit alpha OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q0C0Z8|ATPA_HYPNA | ATP synthase subunit alpha OS=Hyphomonas neptunium (strain ATCC 15444) GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|Q5FRC7|ATPA1_GLUOX | ATP synthase subunit alpha 1 OS=Gluconobacter oxydans (strain 621H) GN=atpA1 PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|A8GY42|ATPA_RICB8 | ATP synthase subunit alpha OS=Rickettsia bellii (strain OSU 85-389) GN=atpA PE=3 SV=1 | 42 | 546 | 0.0E+00 |
| sp|A8GTS8|ATPA_RICRS | ATP synthase subunit alpha OS=Rickettsia rickettsii (strain Sheila Smith) GN=atpA PE=3 SV=1 | 42 | 546 | 0.0E+00 |
| sp|B0BVB8|ATPA_RICRO | ATP synthase subunit alpha OS=Rickettsia rickettsii (strain Iowa) GN=atpA PE=3 SV=2 | 42 | 546 | 0.0E+00 |
| sp|Q92G86|ATPA_RICCN | ATP synthase subunit alpha OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=atpA PE=3 SV=2 | 42 | 546 | 0.0E+00 |
| sp|Q4UK16|ATPA_RICFE | ATP synthase subunit alpha OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=atpA PE=3 SV=1 | 42 | 546 | 0.0E+00 |
| sp|A8F2U2|ATPA_RICM5 | ATP synthase subunit alpha OS=Rickettsia massiliae (strain Mtu5) GN=atpA PE=3 SV=2 | 42 | 546 | 0.0E+00 |
| sp|C4K229|ATPA_RICPU | ATP synthase subunit alpha OS=Rickettsia peacockii (strain Rustic) GN=atpA PE=3 SV=1 | 42 | 546 | 0.0E+00 |
| sp|P05493|ATPAM_PEA | ATP synthase subunit alpha, mitochondrial OS=Pisum sativum GN=ATPA PE=3 SV=2 | 47 | 510 | 0.0E+00 |
| sp|P0C522|ATPAM_ORYSJ | ATP synthase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=ATPA PE=1 SV=1 | 43 | 541 | 0.0E+00 |
| sp|P0C521|ATPAM_ORYSI | ATP synthase subunit alpha, mitochondrial OS=Oryza sativa subsp. indica GN=ATPA PE=3 SV=1 | 43 | 541 | 0.0E+00 |
| sp|P0C520|ATPAM_ORYSA | ATP synthase subunit alpha, mitochondrial OS=Oryza sativa GN=ATPA PE=3 SV=1 | 43 | 541 | 0.0E+00 |
| sp|A8GPZ6|ATPA_RICAH | ATP synthase subunit alpha OS=Rickettsia akari (strain Hartford) GN=atpA PE=3 SV=1 | 42 | 545 | 0.0E+00 |
| sp|Q01915|ATPAM_SOYBN | ATP synthase subunit alpha, mitochondrial OS=Glycine max GN=ATPA PE=3 SV=1 | 47 | 510 | 0.0E+00 |
| sp|P05492|ATPAM_OENBI | ATP synthase subunit alpha, mitochondrial OS=Oenothera biennis GN=ATPA PE=3 SV=1 | 43 | 543 | 0.0E+00 |
| sp|P24459|ATPAM_PHAVU | ATP synthase subunit alpha, mitochondrial OS=Phaseolus vulgaris GN=ATPA PE=3 SV=1 | 47 | 541 | 0.0E+00 |
| sp|O50288|ATPA_RICPR | ATP synthase subunit alpha OS=Rickettsia prowazekii (strain Madrid E) GN=atpA PE=3 SV=2 | 42 | 545 | 0.0E+00 |
| sp|P05494|ATPAM_MAIZE | ATP synthase subunit alpha, mitochondrial OS=Zea mays GN=ATPA PE=3 SV=1 | 43 | 529 | 0.0E+00 |
| sp|Q68VU6|ATPA_RICTY | ATP synthase subunit alpha OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=atpA PE=3 SV=1 | 42 | 545 | 0.0E+00 |
| sp|P18260|ATPAM_HELAN | ATP synthase subunit alpha, mitochondrial OS=Helianthus annuus GN=ATPA PE=3 SV=1 | 43 | 529 | 0.0E+00 |
| sp|B0THN4|ATPA_HELMI | ATP synthase subunit alpha OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|P92549|ATPAM_ARATH | ATP synthase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=ATPA PE=1 SV=2 | 43 | 542 | 0.0E+00 |
| sp|Q06735|ATPAM_BETVU | ATP synthase subunit alpha, mitochondrial OS=Beta vulgaris GN=ATPA PE=3 SV=1 | 43 | 502 | 0.0E+00 |
| sp|P05495|ATPAM_NICPL | ATP synthase subunit alpha, mitochondrial OS=Nicotiana plumbaginifolia GN=ATPA PE=3 SV=1 | 43 | 542 | 0.0E+00 |
| sp|P12862|ATPAM_WHEAT | ATP synthase subunit alpha, mitochondrial OS=Triticum aestivum GN=ATPA PE=3 SV=1 | 43 | 542 | 0.0E+00 |
| sp|P68541|ATPAM_RAPSA | ATP synthase subunit alpha, mitochondrial OS=Raphanus sativus GN=ATPA PE=3 SV=1 | 43 | 502 | 0.0E+00 |
| sp|P68542|ATPAM_BRACM | ATP synthase subunit alpha, mitochondrial OS=Brassica campestris GN=ATPA PE=3 SV=1 | 43 | 502 | 0.0E+00 |
| sp|P22201|ATPAM_BRANA | ATP synthase subunit alpha, mitochondrial OS=Brassica napus GN=ATPA PE=3 SV=1 | 43 | 502 | 0.0E+00 |
| sp|Q2IHQ9|ATPA_ANADE | ATP synthase subunit alpha OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=atpA PE=3 SV=1 | 47 | 541 | 0.0E+00 |
| sp|Q74GY2|ATPA_GEOSL | ATP synthase subunit alpha OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q39Q54|ATPA_GEOMG | ATP synthase subunit alpha OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B3CSS9|ATPA_ORITI | ATP synthase subunit alpha OS=Orientia tsutsugamushi (strain Ikeda) GN=atpA PE=3 SV=1 | 46 | 545 | 0.0E+00 |
| sp|Q3A944|ATPA_CARHZ | ATP synthase subunit alpha OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|B9LZ86|ATPA_GEODF | ATP synthase subunit alpha OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B8JCV2|ATPA_ANAD2 | ATP synthase subunit alpha OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=atpA PE=3 SV=1 | 47 | 541 | 0.0E+00 |
| sp|B4UKF2|ATPA_ANASK | ATP synthase subunit alpha OS=Anaeromyxobacter sp. (strain K) GN=atpA PE=3 SV=1 | 47 | 541 | 0.0E+00 |
| sp|Q313V8|ATPA_DESAG | ATP synthase subunit alpha OS=Desulfovibrio alaskensis (strain G20) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A7HIX9|ATPA_ANADF | ATP synthase subunit alpha OS=Anaeromyxobacter sp. (strain Fw109-5) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A8F006|ATPA_RICCK | ATP synthase subunit alpha OS=Rickettsia canadensis (strain McKiel) GN=atpA PE=3 SV=1 | 42 | 546 | 0.0E+00 |
| sp|A5CD07|ATPA_ORITB | ATP synthase subunit alpha OS=Orientia tsutsugamushi (strain Boryong) GN=atpA PE=3 SV=1 | 46 | 545 | 0.0E+00 |
| sp|B3EA03|ATPA_GEOLS | ATP synthase subunit alpha OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A5G9D6|ATPA_GEOUR | ATP synthase subunit alpha OS=Geobacter uraniireducens (strain Rf4) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q3B1F4|ATPA2_CHLL7 | ATP synthase subunit alpha 2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=atpA2 PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|A1ALL5|ATPA_PELPD | ATP synthase subunit alpha OS=Pelobacter propionicus (strain DSM 2379) GN=atpA1 PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q8KAW8|ATPA_CHLTE | ATP synthase subunit alpha OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|B8DRD0|ATPA_DESVM | ATP synthase subunit alpha OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|C6E9F3|ATPA_GEOSM | ATP synthase subunit alpha OS=Geobacter sp. (strain M21) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B5EFI9|ATPA_GEOBB | ATP synthase subunit alpha OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B4U989|ATPA_HYDS0 | ATP synthase subunit alpha OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=atpA PE=3 SV=1 | 51 | 546 | 0.0E+00 |
| sp|A4SGM9|ATPA_CHLPM | ATP synthase subunit alpha OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|Q24MN9|ATPA_DESHY | ATP synthase subunit alpha OS=Desulfitobacterium hafniense (strain Y51) GN=atpA PE=3 SV=1 | 45 | 547 | 0.0E+00 |
| sp|Q39ZT9|ATPA1_PELCD | ATP synthase subunit alpha 1/3 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=atpA1 PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A1VFJ3|ATPA_DESVV | ATP synthase subunit alpha OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q72E02|ATPA_DESVH | ATP synthase subunit alpha OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A1BJF5|ATPA_CHLPD | ATP synthase subunit alpha OS=Chlorobium phaeobacteroides (strain DSM 266) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|Q3AUA7|ATPA_CHLCH | ATP synthase subunit alpha OS=Chlorobium chlorochromatii (strain CaD3) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|Q6MGM5|ATPA_BDEBA | ATP synthase subunit alpha OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B8FZ36|ATPA_DESHD | ATP synthase subunit alpha OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=atpA PE=3 SV=1 | 45 | 547 | 0.0E+00 |
| sp|A8F3K0|ATPA_PSELT | ATP synthase subunit alpha OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|Q1CWT2|ATPA_MYXXD | ATP synthase subunit alpha OS=Myxococcus xanthus (strain DK 1622) GN=atpA PE=3 SV=2 | 47 | 545 | 0.0E+00 |
| sp|Q07405|ATPA_MYXXA | ATP synthase subunit alpha OS=Myxococcus xanthus GN=atpA PE=1 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B3EL39|ATPA_CHLPB | ATP synthase subunit alpha OS=Chlorobium phaeobacteroides (strain BS1) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|A6TK63|ATPA_ALKMQ | ATP synthase subunit alpha OS=Alkaliphilus metalliredigens (strain QYMF) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|C5CIV6|ATPA_KOSOT | ATP synthase subunit alpha OS=Kosmotoga olearia (strain TBF 19.5.1) GN=atpA PE=3 SV=1 | 42 | 542 | 0.0E+00 |
| sp|B8FGT6|ATPA_DESAA | ATP synthase subunit alpha OS=Desulfatibacillum alkenivorans (strain AK-01) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B8J437|ATPA_DESDA | ATP synthase subunit alpha OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=atpA PE=3 SV=1 | 47 | 541 | 0.0E+00 |
| sp|B4SGC7|ATPA_PELPB | ATP synthase subunit alpha OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|B8CZ12|ATPA_HALOH | ATP synthase subunit alpha OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|B3EHU6|ATPA_CHLL2 | ATP synthase subunit alpha OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|O66907|ATPA_AQUAE | ATP synthase subunit alpha OS=Aquifex aeolicus (strain VF5) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|B5YI22|ATPA_THEYD | ATP synthase subunit alpha OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A8MJW1|ATPA_ALKOO | ATP synthase subunit alpha OS=Alkaliphilus oremlandii (strain OhILAs) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|Q7VJ23|ATPA_HELHP | ATP synthase subunit alpha OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q67TB9|ATPA_SYMTH | ATP synthase subunit alpha OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|A6LJR3|ATPA_THEM4 | ATP synthase subunit alpha OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=atpA PE=3 SV=1 | 44 | 546 | 0.0E+00 |
| sp|A8ZU99|ATPA_DESOH | ATP synthase subunit alpha OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A0LLG0|ATPA_SYNFM | ATP synthase subunit alpha OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A5CYE4|ATPA_PELTS | ATP synthase subunit alpha OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|B0BZL2|ATPA1_ACAM1 | ATP synthase subunit alpha 1 OS=Acaryochloris marina (strain MBIC 11017) GN=atpA1 PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|B7IG42|ATPA_THEAB | ATP synthase subunit alpha OS=Thermosipho africanus (strain TCF52B) GN=atpA PE=3 SV=1 | 44 | 546 | 0.0E+00 |
| sp|B9K7T9|ATPA_THENN | ATP synthase subunit alpha OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|B2V6N6|ATPA_SULSY | ATP synthase subunit alpha OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=atpA PE=3 SV=1 | 47 | 541 | 0.0E+00 |
| sp|B1LBC1|ATPA_THESQ | ATP synthase subunit alpha OS=Thermotoga sp. (strain RQ2) GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|A5ILX0|ATPA_THEP1 | ATP synthase subunit alpha OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|Q9X1U7|ATPA_THEMA | ATP synthase subunit alpha OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=atpA PE=1 SV=1 | 44 | 545 | 0.0E+00 |
| sp|A6Q4C2|ATPA_NITSB | ATP synthase subunit alpha OS=Nitratiruptor sp. (strain SB155-2) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q6AQ12|ATPA_DESPS | ATP synthase subunit alpha OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A7ZC35|ATPA_CAMC1 | ATP synthase subunit alpha OS=Campylobacter concisus (strain 13826) GN=atpA PE=3 SV=1 | 41 | 545 | 0.0E+00 |
| sp|B3QWX7|ATPA_CHLT3 | ATP synthase subunit alpha OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|Q7MA20|ATPA_WOLSU | ATP synthase subunit alpha OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q2LQZ7|ATPA1_SYNAS | ATP synthase subunit alpha 1 OS=Syntrophus aciditrophicus (strain SB) GN=atpA1 PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A7HJV9|ATPA_FERNB | ATP synthase subunit alpha OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=atpA PE=3 SV=1 | 44 | 546 | 0.0E+00 |
| sp|Q5HC95|ATPA_EHRRW | ATP synthase subunit alpha OS=Ehrlichia ruminantium (strain Welgevonden) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|Q5FF66|ATPA_EHRRG | ATP synthase subunit alpha OS=Ehrlichia ruminantium (strain Gardel) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|Q0I7R2|ATPA_SYNS3 | ATP synthase subunit alpha OS=Synechococcus sp. (strain CC9311) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q180W8|ATPA_PEPD6 | ATP synthase subunit alpha OS=Peptoclostridium difficile (strain 630) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q2JIG0|ATPA_SYNJB | ATP synthase subunit alpha OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A7I175|ATPA_CAMHC | ATP synthase subunit alpha OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=atpA PE=3 SV=1 | 41 | 545 | 0.0E+00 |
| sp|A0RR28|ATPA_CAMFF | ATP synthase subunit alpha OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B9DX63|ATPA_CLOK1 | ATP synthase subunit alpha OS=Clostridium kluyveri (strain NBRC 12016) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A8EV72|ATPA_ARCB4 | ATP synthase subunit alpha OS=Arcobacter butzleri (strain RM4018) GN=atpA PE=3 SV=1 | 41 | 545 | 0.0E+00 |
| sp|Q5WB76|ATPA_BACSK | ATP synthase subunit alpha OS=Bacillus clausii (strain KSM-K16) GN=atpA PE=3 SV=1 | 46 | 546 | 0.0E+00 |
| sp|Q8RGE0|ATPA_FUSNN | ATP synthase subunit alpha OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|Q1MRB9|ATPA_LAWIP | ATP synthase subunit alpha OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q2JSW1|ATPA_SYNJA | ATP synthase subunit alpha OS=Synechococcus sp. (strain JA-3-3Ab) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q2RFX7|ATPA_MOOTA | ATP synthase subunit alpha OS=Moorella thermoacetica (strain ATCC 39073) GN=atpA PE=1 SV=1 | 45 | 545 | 0.0E+00 |
| sp|P55987|ATPA_HELPY | ATP synthase subunit alpha OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=atpA PE=3 SV=1 | 47 | 541 | 0.0E+00 |
| sp|B6JMX4|ATPA_HELP2 | ATP synthase subunit alpha OS=Helicobacter pylori (strain P12) GN=atpA PE=3 SV=1 | 47 | 541 | 0.0E+00 |
| sp|C4XI08|ATPA_DESMR | ATP synthase subunit alpha OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=atpA PE=3 SV=1 | 65 | 545 | 0.0E+00 |
| sp|B5Z8D2|ATPA_HELPG | ATP synthase subunit alpha OS=Helicobacter pylori (strain G27) GN=atpA PE=3 SV=1 | 47 | 541 | 0.0E+00 |
| sp|A5N3H9|ATPA_CLOK5 | ATP synthase subunit alpha OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q3YT21|ATPA_EHRCJ | ATP synthase subunit alpha OS=Ehrlichia canis (strain Jake) GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|B2UUP2|ATPA_HELPS | ATP synthase subunit alpha OS=Helicobacter pylori (strain Shi470) GN=atpA PE=3 SV=1 | 47 | 541 | 0.0E+00 |
| sp|Q17Y80|ATPA_HELAH | ATP synthase subunit alpha OS=Helicobacter acinonychis (strain Sheeba) GN=atpA PE=3 SV=1 | 47 | 541 | 0.0E+00 |
| sp|Q2GHX3|ATPA_EHRCR | ATP synthase subunit alpha OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=atpA PE=3 SV=1 | 44 | 520 | 0.0E+00 |
| sp|A7H019|ATPA_CAMC5 | ATP synthase subunit alpha OS=Campylobacter curvus (strain 525.92) GN=atpA PE=3 SV=1 | 41 | 545 | 0.0E+00 |
| sp|Q1CSD3|ATPA_HELPH | ATP synthase subunit alpha OS=Helicobacter pylori (strain HPAG1) GN=atpA PE=3 SV=1 | 47 | 541 | 0.0E+00 |
| sp|Q8DLP3|ATPA_THEEB | ATP synthase subunit alpha OS=Thermosynechococcus elongatus (strain BP-1) GN=atpA PE=1 SV=1 | 45 | 545 | 0.0E+00 |
| sp|A6QB61|ATPA_SULNB | ATP synthase subunit alpha OS=Sulfurovum sp. (strain NBC37-1) GN=atpA PE=3 SV=1 | 47 | 547 | 0.0E+00 |
| sp|Q0SQZ3|ATPA_CLOPS | ATP synthase subunit alpha OS=Clostridium perfringens (strain SM101 / Type A) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|B8HPK1|ATPA_CYAP4 | ATP synthase subunit alpha OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q5HX61|ATPA_CAMJR | ATP synthase subunit alpha OS=Campylobacter jejuni (strain RM1221) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q9PJ21|ATPA_CAMJE | ATP synthase subunit alpha OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A8FJR0|ATPA_CAMJ8 | ATP synthase subunit alpha OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|P56294|ATPA_CHLVU | ATP synthase subunit alpha, chloroplastic OS=Chlorella vulgaris GN=atpA PE=3 SV=1 | 42 | 546 | 0.0E+00 |
| sp|Q8XID2|ATPA_CLOPE | ATP synthase subunit alpha OS=Clostridium perfringens (strain 13 / Type A) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q0TNC2|ATPA_CLOP1 | ATP synthase subunit alpha OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A1VXI8|ATPA_CAMJJ | ATP synthase subunit alpha OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|P29706|ATPA_PROMO | ATP synthase subunit alpha, sodium ion specific OS=Propionigenium modestum GN=atpA PE=1 SV=2 | 42 | 545 | 0.0E+00 |
| sp|Q02BU3|ATPA_SOLUE | ATP synthase subunit alpha OS=Solibacter usitatus (strain Ellin6076) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q9K6H3|ATPA_BACHD | ATP synthase subunit alpha OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=atpA PE=3 SV=1 | 45 | 544 | 0.0E+00 |
| sp|Q30QP9|ATPA_SULDN | ATP synthase subunit alpha OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=atpA PE=3 SV=1 | 41 | 546 | 0.0E+00 |
| sp|Q11YP1|ATPA_CYTH3 | ATP synthase subunit alpha OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=atpA PE=3 SV=1 | 45 | 539 | 0.0E+00 |
| sp|A0Q2Z6|ATPA_CLONN | ATP synthase subunit alpha OS=Clostridium novyi (strain NT) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q0AUD1|ATPA_SYNWW | ATP synthase subunit alpha OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|A4J9A1|ATPA_DESRM | ATP synthase subunit alpha OS=Desulfotomaculum reducens (strain MI-1) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|P27179|ATPA_SYNY3 | ATP synthase subunit alpha OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|B7KKR4|ATPA_CYAP7 | ATP synthase subunit alpha OS=Cyanothece sp. (strain PCC 7424) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|C0Z778|ATPA_BREBN | ATP synthase subunit alpha OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=atpA PE=3 SV=1 | 45 | 541 | 0.0E+00 |
| sp|B2J058|ATPA_NOSP7 | ATP synthase subunit alpha OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|B7K5I8|ATPA_CYAP8 | ATP synthase subunit alpha OS=Cyanothece sp. (strain PCC 8801) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|P22477|ATPA_BACPE | ATP synthase subunit alpha OS=Bacillus pseudofirmus (strain OF4) GN=atpA PE=3 SV=2 | 45 | 545 | 0.0E+00 |
| sp|B2A3G4|ATPA_NATTJ | ATP synthase subunit alpha OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|B3CN53|ATPA_WOLPP | ATP synthase subunit alpha OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|Q9ZK79|ATPA_HELPJ | ATP synthase subunit alpha OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=atpA PE=3 SV=1 | 47 | 541 | 0.0E+00 |
| sp|A7H1H9|ATPA_CAMJD | ATP synthase subunit alpha OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q7V037|ATPA_PROMP | ATP synthase subunit alpha OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q9Z689|ATPA_CLOAB | ATP synthase subunit alpha OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q1ACM8|ATPA_CHAVU | ATP synthase subunit alpha, chloroplastic OS=Chara vulgaris GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A9BCD9|ATPA_PROM4 | ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9211) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A5GNC8|ATPA_SYNPW | ATP synthase subunit alpha OS=Synechococcus sp. (strain WH7803) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q05372|ATPA_SYNP1 | ATP synthase subunit alpha OS=Synechococcus sp. (strain PCC 6716) GN=atpA PE=1 SV=4 | 45 | 545 | 0.0E+00 |
| sp|Q7U8W5|ATPA_SYNPX | ATP synthase subunit alpha OS=Synechococcus sp. (strain WH8102) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q318U1|ATPA_PROM9 | ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9312) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A6LQH4|ATPA_CLOB8 | ATP synthase subunit alpha OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q20EV9|ATPA_OLTVI | ATP synthase subunit alpha, chloroplastic OS=Oltmannsiellopsis viridis GN=atpA PE=3 SV=1 | 42 | 536 | 0.0E+00 |
| sp|O78475|ATPA_GUITH | ATP synthase subunit alpha, chloroplastic OS=Guillardia theta GN=atpA PE=3 SV=1 | 45 | 542 | 0.0E+00 |
| sp|Q9MUT2|ATPA_MESVI | ATP synthase subunit alpha, chloroplastic OS=Mesostigma viride GN=atpA PE=3 SV=1 | 42 | 545 | 0.0E+00 |
| sp|P17674|ATPA_BACMQ | ATP synthase subunit alpha OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|Q31RF1|ATPA_SYNE7 | ATP synthase subunit alpha OS=Synechococcus elongatus (strain PCC 7942) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A2BYH6|ATPA_PROM5 | ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9515) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|P08449|ATPA_SYNP6 | ATP synthase subunit alpha OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A0PUK2|ATPA_MYCUA | ATP synthase subunit alpha OS=Mycobacterium ulcerans (strain Agy99) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A0R202|ATPA_MYCS2 | ATP synthase subunit alpha OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=atpA PE=1 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B2HQK4|ATPA_MYCMM | ATP synthase subunit alpha OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q73HB2|ATPA_WOLPM | ATP synthase subunit alpha OS=Wolbachia pipientis wMel GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|Q7VA63|ATPA_PROMA | ATP synthase subunit alpha OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|C0R2Y2|ATPA_WOLWR | ATP synthase subunit alpha OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|Q112Z6|ATPA_TRIEI | ATP synthase subunit alpha OS=Trichodesmium erythraeum (strain IMS101) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q37380|ATPA_ACACA | ATP synthase subunit alpha, mitochondrial OS=Acanthamoeba castellanii GN=ATP1 PE=3 SV=1 | 42 | 514 | 0.0E+00 |
| sp|B2KEX0|ATPA_ELUMP | ATP synthase subunit alpha OS=Elusimicrobium minutum (strain Pei191) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B2TJZ8|ATPA_CLOBB | ATP synthase subunit alpha OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A9KK94|ATPA_CLOPH | ATP synthase subunit alpha OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|Q73X57|ATPA_MYCPA | ATP synthase subunit alpha OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A0QCX6|ATPA_MYCA1 | ATP synthase subunit alpha OS=Mycobacterium avium (strain 104) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A2BT25|ATPA_PROMS | ATP synthase subunit alpha OS=Prochlorococcus marinus (strain AS9601) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q5P9M4|ATPA_ANAMM | ATP synthase subunit alpha OS=Anaplasma marginale (strain St. Maries) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B9KH09|ATPA_ANAMF | ATP synthase subunit alpha OS=Anaplasma marginale (strain Florida) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A0M6G4|ATPA_GRAFK | ATP synthase subunit alpha OS=Gramella forsetii (strain KT0803) GN=atpA PE=3 SV=1 | 41 | 536 | 0.0E+00 |
| sp|Q9TM26|ATPA_CYACA | ATP synthase subunit alpha, chloroplastic OS=Cyanidium caldarium GN=atpA PE=3 SV=1 | 45 | 535 | 0.0E+00 |
| sp|A5GV72|ATPA_SYNR3 | ATP synthase subunit alpha OS=Synechococcus sp. (strain RCC307) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q32RS8|ATPA_STAPU | ATP synthase subunit alpha, chloroplastic OS=Staurastrum punctulatum GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q1LHK8|ATPA_CUPMC | ATP synthase subunit alpha OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=atpA PE=3 SV=1 | 44 | 544 | 0.0E+00 |
| sp|B2UZJ8|ATPA_CLOBA | ATP synthase subunit alpha OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q46J57|ATPA_PROMT | ATP synthase subunit alpha OS=Prochlorococcus marinus (strain NATL2A) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A8G6V1|ATPA_PROM2 | ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9215) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|B9KES1|ATPA_CAMLR | ATP synthase subunit alpha OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=atpA PE=3 SV=1 | 47 | 541 | 0.0E+00 |
| sp|P12405|ATPA_NOSS1 | ATP synthase subunit alpha OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=atpA PE=3 SV=2 | 45 | 545 | 0.0E+00 |
| sp|Q0VKX2|ATPA_ALCBS | ATP synthase subunit alpha OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|A3PET9|ATPA_PROM0 | ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9301) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q3AZM1|ATPA_SYNS9 | ATP synthase subunit alpha OS=Synechococcus sp. (strain CC9902) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A9L981|ATPA_LEMMI | ATP synthase subunit alpha, chloroplastic OS=Lemna minor GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|C1F3N8|ATPA_ACIC5 | ATP synthase subunit alpha OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|C4KYS5|ATPA_EXISA | ATP synthase subunit alpha OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q5GSX1|ATPA_WOLTR | ATP synthase subunit alpha OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=atpA PE=3 SV=1 | 44 | 547 | 0.0E+00 |
| sp|A2C4J5|ATPA_PROM1 | ATP synthase subunit alpha OS=Prochlorococcus marinus (strain NATL1A) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q8S8Y3|ATPA_ATRBE | ATP synthase subunit alpha, chloroplastic OS=Atropa belladonna GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q85FQ8|ATPA_CYAME | ATP synthase subunit alpha, chloroplastic OS=Cyanidioschyzon merolae GN=atpA PE=3 SV=1 | 45 | 537 | 0.0E+00 |
| sp|Q2GIG2|ATPA_ANAPZ | ATP synthase subunit alpha OS=Anaplasma phagocytophilum (strain HZ) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|P26679|ATPA_ENTHA | ATP synthase subunit alpha OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A6MVW4|ATPA_RHDSA | ATP synthase subunit alpha, chloroplastic OS=Rhodomonas salina GN=atpA PE=3 SV=1 | 45 | 541 | 0.0E+00 |
| sp|Q71WP7|ATPA2_LISMF | ATP synthase subunit alpha 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=atpA2 PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|A5WBV9|ATPA_PSYWF | ATP synthase subunit alpha OS=Psychrobacter sp. (strain PRwf-1) GN=atpA PE=3 SV=1 | 44 | 544 | 0.0E+00 |
| sp|A4QKR6|ATPA_CRUWA | ATP synthase subunit alpha, chloroplastic OS=Crucihimalaya wallichii GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q8EM81|ATPA_OCEIH | ATP synthase subunit alpha OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=atpA PE=3 SV=1 | 44 | 546 | 0.0E+00 |
| sp|P06450|ATPA_SPIOL | ATP synthase subunit alpha, chloroplastic OS=Spinacia oleracea GN=atpA PE=1 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q3M9W0|ATPA_ANAVT | ATP synthase subunit alpha OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=atpA PE=3 SV=2 | 45 | 545 | 0.0E+00 |
| sp|Q1AVH7|ATPA_RUBXD | ATP synthase subunit alpha OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|Q7V5S7|ATPA_PROMM | ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9313) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A6W3T0|ATPA2_MARMS | ATP synthase subunit alpha 2 OS=Marinomonas sp. (strain MWYL1) GN=atpA2 PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|Q1IIG6|ATPA_KORVE | ATP synthase subunit alpha OS=Koribacter versatilis (strain Ellin345) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A4QK03|ATPA_ARAHI | ATP synthase subunit alpha, chloroplastic OS=Arabis hirsuta GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q8Y4C0|ATPA2_LISMO | ATP synthase subunit alpha 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=atpA2 PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|P48080|ATPA_CYAPA | ATP synthase subunit alpha, cyanelle OS=Cyanophora paradoxa GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q9BBS3|ATPA_LOTJA | ATP synthase subunit alpha, chloroplastic OS=Lotus japonicus GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|P35009|ATPA_GALSU | ATP synthase subunit alpha, chloroplastic OS=Galdieria sulphuraria GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q6MAK5|ATPA_PARUW | ATP synthase subunit alpha OS=Protochlamydia amoebophila (strain UWE25) GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|P9WPU7|ATPA_MYCTU | ATP synthase subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=atpA PE=1 SV=1 | 47 | 545 | 0.0E+00 |
| sp|P9WPU6|ATPA_MYCTO | ATP synthase subunit alpha OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A5U207|ATPA_MYCTA | ATP synthase subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|C1AMV2|ATPA_MYCBT | ATP synthase subunit alpha OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A1KI96|ATPA_MYCBP | ATP synthase subunit alpha OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|P63674|ATPA_MYCBO | ATP synthase subunit alpha OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B9L1H1|ATPA_THERP | ATP synthase subunit alpha OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|A0ALL5|ATPA2_LISW6 | ATP synthase subunit alpha 2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=atpA2 PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|A4GGB2|ATPA_PHAVU | ATP synthase subunit alpha, chloroplastic OS=Phaseolus vulgaris GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q65DX2|ATPA_BACLD | ATP synthase subunit alpha OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A4QJI4|ATPA_AETGR | ATP synthase subunit alpha, chloroplastic OS=Aethionema grandiflorum GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A4QJA0|ATPA_AETCO | ATP synthase subunit alpha, chloroplastic OS=Aethionema cordifolium GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q927W2|ATPA2_LISIN | ATP synthase subunit alpha 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=atpA2 PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|B3PIS9|ATPA_CELJU | ATP synthase subunit alpha OS=Cellvibrio japonicus (strain Ueda107) GN=atpA PE=3 SV=1 | 44 | 537 | 0.0E+00 |
| sp|A4QL91|ATPA_LEPVR | ATP synthase subunit alpha, chloroplastic OS=Lepidium virginicum GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q2PMS8|ATPA_SOYBN | ATP synthase subunit alpha, chloroplastic OS=Glycine max GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A4QLR8|ATPA_NASOF | ATP synthase subunit alpha, chloroplastic OS=Nasturtium officinale GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A4QJR8|ATPA_OLIPU | ATP synthase subunit alpha, chloroplastic OS=Olimarabidopsis pumila GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|C1FQP3|ATPA_CLOBJ | ATP synthase subunit alpha OS=Clostridium botulinum (strain Kyoto / Type A2) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A5HY50|ATPA_CLOBH | ATP synthase subunit alpha OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|C3KYJ1|ATPA_CLOB6 | ATP synthase subunit alpha OS=Clostridium botulinum (strain 657 / Type Ba4) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A7FQH7|ATPA_CLOB1 | ATP synthase subunit alpha OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A4QLH9|ATPA_LOBMA | ATP synthase subunit alpha, chloroplastic OS=Lobularia maritima GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q1QSC8|ATPA_CHRSD | ATP synthase subunit alpha OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|Q00820|ATPA_ODOSI | ATP synthase subunit alpha, chloroplastic OS=Odontella sinensis GN=atpA PE=3 SV=1 | 45 | 536 | 0.0E+00 |
| sp|A4QL04|ATPA_DRANE | ATP synthase subunit alpha, chloroplastic OS=Draba nemorosa GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A7Z9Q2|ATPA_BACMF | ATP synthase subunit alpha OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B1NWD5|ATPA_MANES | ATP synthase subunit alpha, chloroplastic OS=Manihot esculenta GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|P56757|ATPA_ARATH | ATP synthase subunit alpha, chloroplastic OS=Arabidopsis thaliana GN=atpA PE=1 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q49L13|ATPA_EUCGG | ATP synthase subunit alpha, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q27S65|ATPA_SOLTU | ATP synthase subunit alpha, chloroplastic OS=Solanum tuberosum GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q2MIB5|ATPA_SOLLC | ATP synthase subunit alpha, chloroplastic OS=Solanum lycopersicum GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q2MIK2|ATPA_SOLBU | ATP synthase subunit alpha, chloroplastic OS=Solanum bulbocastanum GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A7G9Q7|ATPA_CLOBL | ATP synthase subunit alpha OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q6EW63|ATPA_NYMAL | ATP synthase subunit alpha, chloroplastic OS=Nymphaea alba GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q4G397|ATPA_EMIHU | ATP synthase subunit alpha, chloroplastic OS=Emiliania huxleyi GN=atpA PE=3 SV=1 | 45 | 537 | 0.0E+00 |
| sp|A4QK90|ATPA_BARVE | ATP synthase subunit alpha, chloroplastic OS=Barbarea verna GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|B0JWV1|ATPA_MICAN | ATP synthase subunit alpha OS=Microcystis aeruginosa (strain NIES-843) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|A4GYP3|ATPA_POPTR | ATP synthase subunit alpha, chloroplastic OS=Populus trichocarpa GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q14FH2|ATPA_POPAL | ATP synthase subunit alpha, chloroplastic OS=Populus alba GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A4QKH7|ATPA_CAPBU | ATP synthase subunit alpha, chloroplastic OS=Capsella bursa-pastoris GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|B1IE32|ATPA_CLOBK | ATP synthase subunit alpha OS=Clostridium botulinum (strain Okra / Type B1) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|P30392|ATPA_EUGGR | ATP synthase subunit alpha, chloroplastic OS=Euglena gracilis GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|A2RMI4|ATPA_LACLM | ATP synthase subunit alpha OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=atpA PE=3 SV=1 | 47 | 541 | 0.0E+00 |
| sp|A8SE59|ATPA_CERDE | ATP synthase subunit alpha, chloroplastic OS=Ceratophyllum demersum GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q21DK6|ATPA_SACD2 | ATP synthase subunit alpha OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|B1KSS6|ATPA_CLOBM | ATP synthase subunit alpha OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q3C1H4|ATPA_NICSY | ATP synthase subunit alpha, chloroplastic OS=Nicotiana sylvestris GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A7GV58|ATPA_BACCN | ATP synthase subunit alpha OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|A0T0F1|ATPA_PHATC | ATP synthase subunit alpha, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=atpA PE=3 SV=1 | 45 | 536 | 0.0E+00 |
| sp|A1TD57|ATPA_MYCVP | ATP synthase subunit alpha OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=atpA PE=3 SV=1 | 46 | 545 | 0.0E+00 |
| sp|Q1KXW5|ATPA_HELAN | ATP synthase subunit alpha, chloroplastic OS=Helianthus annuus GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A0T0P4|ATPA_THAPS | ATP synthase subunit alpha, chloroplastic OS=Thalassiosira pseudonana GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|P00823|ATPA_TOBAC | ATP synthase subunit alpha, chloroplastic OS=Nicotiana tabacum GN=atpA PE=2 SV=2 | 47 | 546 | 0.0E+00 |
| sp|Q5H4Y6|ATPA_XANOR | ATP synthase subunit alpha OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|B2SQB2|ATPA_XANOP | ATP synthase subunit alpha OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|Q2P7Q6|ATPA_XANOM | ATP synthase subunit alpha OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|A1XGM3|ATPA_RANMC | ATP synthase subunit alpha, chloroplastic OS=Ranunculus macranthus GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A7Y3A4|ATPA_IPOPU | ATP synthase subunit alpha, chloroplastic OS=Ipomoea purpurea GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q33C53|ATPA_NICTO | ATP synthase subunit alpha, chloroplastic OS=Nicotiana tomentosiformis GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|C1D5G4|ATPA_LARHH | ATP synthase subunit alpha OS=Laribacter hongkongensis (strain HLHK9) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|Q09X32|ATPA_MORIN | ATP synthase subunit alpha, chloroplastic OS=Morus indica GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|P51242|ATPA_PORPU | ATP synthase subunit alpha, chloroplastic OS=Porphyra purpurea GN=atpA PE=3 SV=1 | 45 | 544 | 0.0E+00 |
| sp|Q1Q897|ATPA_PSYCK | ATP synthase subunit alpha OS=Psychrobacter cryohalolentis (strain K5) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|Q6YXK3|ATPA_PHYPA | ATP synthase subunit alpha, chloroplastic OS=Physcomitrella patens subsp. patens GN=atpA PE=3 SV=1 | 42 | 546 | 0.0E+00 |
| sp|Q8CNJ5|ATPA_STAES | ATP synthase subunit alpha OS=Staphylococcus epidermidis (strain ATCC 12228) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|Q5HMB7|ATPA_STAEQ | ATP synthase subunit alpha OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|A9VSA5|ATPA_BACWK | ATP synthase subunit alpha OS=Bacillus weihenstephanensis (strain KBAB4) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|Q8MA05|ATPA_CHAGL | ATP synthase subunit alpha, chloroplastic OS=Chaetosphaeridium globosum GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q1B551|ATPA_MYCSS | ATP synthase subunit alpha OS=Mycobacterium sp. (strain MCS) GN=atpA PE=3 SV=1 | 73 | 545 | 0.0E+00 |
| sp|A1UJY6|ATPA_MYCSK | ATP synthase subunit alpha OS=Mycobacterium sp. (strain KMS) GN=atpA PE=3 SV=1 | 73 | 545 | 0.0E+00 |
| sp|A3Q3B3|ATPA_MYCSJ | ATP synthase subunit alpha OS=Mycobacterium sp. (strain JLS) GN=atpA PE=3 SV=1 | 73 | 545 | 0.0E+00 |
| sp|Q3AHK5|ATPA_SYNSC | ATP synthase subunit alpha OS=Synechococcus sp. (strain CC9605) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q06GS5|ATPA_PIPCE | ATP synthase subunit alpha, chloroplastic OS=Piper cenocladum GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q02848|ATPA_ANTSP | ATP synthase subunit alpha, chloroplastic OS=Antithamnion sp. GN=atpA PE=3 SV=1 | 45 | 541 | 0.0E+00 |
| sp|B7IQW0|ATPA_BACC2 | ATP synthase subunit alpha OS=Bacillus cereus (strain G9842) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|Q6HAX7|ATPA_BACHK | ATP synthase subunit alpha OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|Q630U1|ATPA_BACCZ | ATP synthase subunit alpha OS=Bacillus cereus (strain ZK / E33L) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|B9IRT9|ATPA_BACCQ | ATP synthase subunit alpha OS=Bacillus cereus (strain Q1) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|B7HY67|ATPA_BACC7 | ATP synthase subunit alpha OS=Bacillus cereus (strain AH187) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|C1F0N0|ATPA_BACC3 | ATP synthase subunit alpha OS=Bacillus cereus (strain 03BB102) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|Q72XE6|ATPA_BACC1 | ATP synthase subunit alpha OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|B7JGN2|ATPA_BACC0 | ATP synthase subunit alpha OS=Bacillus cereus (strain AH820) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|Q81JZ3|ATPA_BACAN | ATP synthase subunit alpha OS=Bacillus anthracis GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|A0RL97|ATPA_BACAH | ATP synthase subunit alpha OS=Bacillus thuringiensis (strain Al Hakam) GN=atpA PE=3 SV=2 | 47 | 520 | 0.0E+00 |
| sp|C3LFI1|ATPA_BACAC | ATP synthase subunit alpha OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|C3P1F6|ATPA_BACAA | ATP synthase subunit alpha OS=Bacillus anthracis (strain A0248) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|Q32RL1|ATPA_ZYGCR | ATP synthase subunit alpha, chloroplastic OS=Zygnema circumcarinatum GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q3ZJ00|ATPA_PSEAK | ATP synthase subunit alpha, chloroplastic OS=Pseudendoclonium akinetum GN=atpA PE=3 SV=1 | 42 | 536 | 0.0E+00 |
| sp|Q4FQ35|ATPA_PSYA2 | ATP synthase subunit alpha OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|B1I6J9|ATPA_DESAP | ATP synthase subunit alpha OS=Desulforudis audaxviator (strain MP104C) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q814W0|ATPA_BACCR | ATP synthase subunit alpha OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|B7HFK4|ATPA_BACC4 | ATP synthase subunit alpha OS=Bacillus cereus (strain B4264) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|Q6B8Q8|ATPA_GRATL | ATP synthase subunit alpha, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=atpA PE=3 SV=1 | 45 | 541 | 0.0E+00 |
| sp|Q2L8Z1|ATPA_GOSHI | ATP synthase subunit alpha, chloroplastic OS=Gossypium hirsutum GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q47M80|ATPA_THEFY | ATP synthase subunit alpha OS=Thermobifida fusca (strain YX) GN=atpA PE=3 SV=1 | 45 | 545 | 0.0E+00 |
| sp|Q589B3|ATPA_SILLA | ATP synthase subunit alpha, chloroplastic OS=Silene latifolia GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q8RC17|ATPA_CALS4 | ATP synthase subunit alpha OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=atpA PE=3 SV=1 | 45 | 535 | 0.0E+00 |
| sp|A1K1S0|ATPA_AZOSB | ATP synthase subunit alpha OS=Azoarcus sp. (strain BH72) GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|Q19VA5|ATPA_CHLAT | ATP synthase subunit alpha, chloroplastic OS=Chlorokybus atmophyticus GN=atpA PE=3 SV=2 | 42 | 545 | 0.0E+00 |
| sp|Q06FX6|ATPA_PELHO | ATP synthase subunit alpha, chloroplastic OS=Pelargonium hortorum GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q477Z3|ATPA_DECAR | ATP synthase subunit alpha OS=Dechloromonas aromatica (strain RCB) GN=atpA PE=3 SV=1 | 44 | 546 | 0.0E+00 |
| sp|Q4L7Y6|ATPA_STAHJ | ATP synthase subunit alpha OS=Staphylococcus haemolyticus (strain JCSC1435) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|P08215|ATPA_PEA | ATP synthase subunit alpha, chloroplastic OS=Pisum sativum GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A3DIM7|ATPA_CLOTH | ATP synthase subunit alpha OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q85AU2|ATPA_ANTFO | ATP synthase subunit alpha, chloroplastic OS=Anthoceros formosae GN=atpA PE=2 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q1XDP5|ATPA_PYRYE | ATP synthase subunit alpha, chloroplastic OS=Pyropia yezoensis GN=atpA PE=3 SV=1 | 45 | 544 | 0.0E+00 |
| sp|Q8PCZ7|ATPA_XANCP | ATP synthase subunit alpha OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|B0RWC4|ATPA_XANCB | ATP synthase subunit alpha OS=Xanthomonas campestris pv. campestris (strain B100) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|Q4UQF2|ATPA_XANC8 | ATP synthase subunit alpha OS=Xanthomonas campestris pv. campestris (strain 8004) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|Q3BP13|ATPA_XANC5 | ATP synthase subunit alpha OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|Q8PGG5|ATPA_XANAC | ATP synthase subunit alpha OS=Xanthomonas axonopodis pv. citri (strain 306) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|B1MLW0|ATPA_MYCA9 | ATP synthase subunit alpha OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|A8W3H5|ATPA_CUSOB | ATP synthase subunit alpha, plastid OS=Cuscuta obtusiflora GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A7M8Y9|ATPA_CUSGR | ATP synthase subunit alpha, plastid OS=Cuscuta gronovii GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q2S6N9|ATPA2_HAHCH | ATP synthase subunit alpha 2 OS=Hahella chejuensis (strain KCTC 2396) GN=atpA2 PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|A4GAH1|ATPA_HERAR | ATP synthase subunit alpha OS=Herminiimonas arsenicoxydans GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|B1A920|ATPA_CARPA | ATP synthase subunit alpha, chloroplastic OS=Carica papaya GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|B0SLC6|ATPA_LEPBP | ATP synthase subunit alpha OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|B0SDA3|ATPA_LEPBA | ATP synthase subunit alpha OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|C5D992|ATPA_GEOSW | ATP synthase subunit alpha OS=Geobacillus sp. (strain WCH70) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A8FIB4|ATPA_BACP2 | ATP synthase subunit alpha OS=Bacillus pumilus (strain SAFR-032) GN=atpA PE=3 SV=1 | 47 | 531 | 0.0E+00 |
| sp|A9BFX5|ATPA_PETMO | ATP synthase subunit alpha OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|P37808|ATPA_BACSU | ATP synthase subunit alpha OS=Bacillus subtilis (strain 168) GN=atpA PE=1 SV=3 | 47 | 545 | 0.0E+00 |
| sp|A6YG64|ATPA_LEPTE | ATP synthase subunit alpha, chloroplastic OS=Leptosira terrestris GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q09G61|ATPA_PLAOC | ATP synthase subunit alpha, chloroplastic OS=Platanus occidentalis GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q5P4E4|ATPA_AROAE | ATP synthase subunit alpha OS=Aromatoleum aromaticum (strain EbN1) GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|Q2S432|ATPA_SALRD | ATP synthase subunit alpha OS=Salinibacter ruber (strain DSM 13855 / M31) GN=atpA PE=3 SV=1 | 45 | 520 | 0.0E+00 |
| sp|Q49Z52|ATPA_STAS1 | ATP synthase subunit alpha OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|B9E8E8|ATPA_MACCJ | ATP synthase subunit alpha OS=Macrococcus caseolyticus (strain JCSC5402) GN=atpA PE=3 SV=1 | 47 | 512 | 0.0E+00 |
| sp|Q06RE6|ATPA_JASNU | ATP synthase subunit alpha, chloroplastic OS=Jasminum nudiflorum GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|C5BKJ7|ATPA_TERTT | ATP synthase subunit alpha OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|Q0ZJ35|ATPA_VITVI | ATP synthase subunit alpha, chloroplastic OS=Vitis vinifera GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q13SQ0|ATPA2_BURXL | ATP synthase subunit alpha 2 OS=Burkholderia xenovorans (strain LB400) GN=atpA2 PE=3 SV=1 | 44 | 544 | 0.0E+00 |
| sp|P06283|ATPA_MARPO | ATP synthase subunit alpha, chloroplastic OS=Marchantia polymorpha GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|Q2QDA3|ATPA_CUCSA | ATP synthase subunit alpha, chloroplastic OS=Cucumis sativus GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|P45825|ATPA_MYCLE | ATP synthase subunit alpha OS=Mycobacterium leprae (strain TN) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|B8ZR40|ATPA_MYCLB | ATP synthase subunit alpha OS=Mycobacterium leprae (strain Br4923) GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q09MJ3|ATPA_CITSI | ATP synthase subunit alpha, chloroplastic OS=Citrus sinensis GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A4ITJ1|ATPA_GEOTN | ATP synthase subunit alpha OS=Geobacillus thermodenitrificans (strain NG80-2) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q0G9X7|ATPA_DAUCA | ATP synthase subunit alpha, chloroplastic OS=Daucus carota GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|B0KRB0|ATPA_PSEPG | ATP synthase subunit alpha OS=Pseudomonas putida (strain GB-1) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|A0ZZ20|ATPA_GOSBA | ATP synthase subunit alpha, chloroplastic OS=Gossypium barbadense GN=atpA PE=3 SV=1 | 47 | 545 | 0.0E+00 |
| sp|Q5KUJ1|ATPA_GEOKA | ATP synthase subunit alpha OS=Geobacillus kaustophilus (strain HTA426) GN=atpA PE=1 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q831A3|ATPA_ENTFA | ATP synthase subunit alpha OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|Q7YJY4|ATPA_CALFG | ATP synthase subunit alpha, chloroplastic OS=Calycanthus floridus var. glaucus GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q223D4|ATPA1_RHOFT | ATP synthase subunit alpha 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=atpA1 PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|A4T8K0|ATPA_MYCGI | ATP synthase subunit alpha OS=Mycobacterium gilvum (strain PYR-GCK) GN=atpA PE=3 SV=1 | 46 | 545 | 0.0E+00 |
| sp|Q0K5M5|ATPA_CUPNH | ATP synthase subunit alpha OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=atpA PE=3 SV=1 | 44 | 544 | 0.0E+00 |
| sp|Q04ZU3|ATPA_LEPBL | ATP synthase subunit alpha OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q04S16|ATPA_LEPBJ | ATP synthase subunit alpha OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|B2Y1W2|ATPA_WELMI | ATP synthase subunit alpha, chloroplastic OS=Welwitschia mirabilis GN=atpA PE=3 SV=1 | 45 | 542 | 0.0E+00 |
| sp|Q88UU1|ATPA_LACPL | ATP synthase subunit alpha OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=atpA PE=3 SV=1 | 47 | 520 | 0.0E+00 |
| sp|Q9KNH3|ATPA_VIBCH | ATP synthase subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=atpA PE=3 SV=2 | 44 | 541 | 0.0E+00 |
| sp|A5F457|ATPA_VIBC3 | ATP synthase subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|A1XFU0|ATPA_NUPAD | ATP synthase subunit alpha, chloroplastic OS=Nuphar advena GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A7M951|ATPA_CUSRE | ATP synthase subunit alpha, plastid OS=Cuscuta reflexa GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A6MM21|ATPA_BUXMI | ATP synthase subunit alpha, chloroplastic OS=Buxus microphylla GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A6MMJ2|ATPA_DIOEL | ATP synthase subunit alpha, chloroplastic OS=Dioscorea elephantipes GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A6L8N5|ATPA_PARD8 | ATP synthase subunit alpha OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=atpA PE=3 SV=1 | 46 | 541 | 0.0E+00 |
| sp|A4Y189|ATPA_PSEMY | ATP synthase subunit alpha OS=Pseudomonas mendocina (strain ymp) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|P63676|ATPA_STAAW | ATP synthase subunit alpha OS=Staphylococcus aureus (strain MW2) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|A8YY72|ATPA_STAAT | ATP synthase subunit alpha OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|Q6G7K5|ATPA_STAAS | ATP synthase subunit alpha OS=Staphylococcus aureus (strain MSSA476) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|Q6GEX0|ATPA_STAAR | ATP synthase subunit alpha OS=Staphylococcus aureus (strain MRSA252) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|P99111|ATPA_STAAN | ATP synthase subunit alpha OS=Staphylococcus aureus (strain N315) GN=atpA PE=1 SV=1 | 47 | 544 | 0.0E+00 |
| sp|P63675|ATPA_STAAM | ATP synthase subunit alpha OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|A5IUQ0|ATPA_STAA9 | ATP synthase subunit alpha OS=Staphylococcus aureus (strain JH9) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|Q2FWE8|ATPA_STAA8 | ATP synthase subunit alpha OS=Staphylococcus aureus (strain NCTC 8325) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|Q2FF22|ATPA_STAA3 | ATP synthase subunit alpha OS=Staphylococcus aureus (strain USA300) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|A6U3J0|ATPA_STAA2 | ATP synthase subunit alpha OS=Staphylococcus aureus (strain JH1) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|A7X4U5|ATPA_STAA1 | ATP synthase subunit alpha OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|A0A320|ATPA_COFAR | ATP synthase subunit alpha, chloroplastic OS=Coffea arabica GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A6T472|ATPA_JANMA | ATP synthase subunit alpha OS=Janthinobacterium sp. (strain Marseille) GN=atpA PE=3 SV=1 | 44 | 545 | 0.0E+00 |
| sp|A9AJG2|ATPA_BURM1 | ATP synthase subunit alpha OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=atpA PE=3 SV=1 | 44 | 544 | 0.0E+00 |
| sp|Q2YUJ9|ATPA_STAAB | ATP synthase subunit alpha OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=atpA PE=3 SV=1 | 47 | 544 | 0.0E+00 |
| sp|A6MMA7|ATPA_CHLSC | ATP synthase subunit alpha, chloroplastic OS=Chloranthus spicatus GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q09FX6|ATPA_NANDO | ATP synthase subunit alpha, chloroplastic OS=Nandina domestica GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A5FL34|ATPA_FLAJ1 | ATP synthase subunit alpha OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=atpA PE=3 SV=1 | 41 | 541 | 0.0E+00 |
| sp|B1JFU3|ATPA_PSEPW | ATP synthase subunit alpha OS=Pseudomonas putida (strain W619) GN=atpA PE=3 SV=1 | 44 | 541 | 0.0E+00 |
| sp|P09219|ATPA_BACP3 | ATP synthase subunit alpha OS=Bacillus sp. (strain PS3) GN=atpA PE=1 SV=1 | 47 | 546 | 0.0E+00 |
| sp|B0Z5D4|ATPA_OENPA | ATP synthase subunit alpha, chloroplastic OS=Oenothera parviflora GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|B0Z4N2|ATPA_OENAR | ATP synthase subunit alpha, chloroplastic OS=Oenothera argillicola GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|A6H5F1|ATPA_CYCTA | ATP synthase subunit alpha, chloroplastic OS=Cycas taitungensis GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A2C6X5|ATPA_PROM3 | ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9303) GN=atpA PE=3 SV=1 | 45 | 546 | 0.0E+00 |
| sp|A6H2D7|ATPA_FLAPJ | ATP synthase subunit alpha OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=atpA PE=3 SV=1 | 41 | 545 | 0.0E+00 |
| sp|A4JA33|ATPA_BURVG | ATP synthase subunit alpha OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=atpA PE=3 SV=1 | 44 | 544 | 0.0E+00 |
| sp|Q39KX8|ATPA_BURL3 | ATP synthase subunit alpha OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=atpA PE=3 SV=1 | 44 | 544 | 0.0E+00 |
| sp|Q06H12|ATPA_DRIGR | ATP synthase subunit alpha, chloroplastic OS=Drimys granadensis GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|B0Z550|ATPA_OENGL | ATP synthase subunit alpha, chloroplastic OS=Oenothera glazioviana GN=atpA PE=3 SV=1 | 47 | 546 | 0.0E+00 |
| sp|Q8F2J2|ATPA_LEPIN | ATP synthase subunit alpha OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=atpA PE=3 SV=2 | 47 | 546 | 0.0E+00 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005524 | ATP binding | Yes |
| GO:1902600 | proton transmembrane transport | Yes |
| GO:0046034 | ATP metabolic process | Yes |
| GO:0015986 | proton motive force-driven ATP synthesis | Yes |
| GO:0006810 | transport | No |
| GO:0009260 | ribonucleotide biosynthetic process | No |
| GO:0098655 | cation transmembrane transport | No |
| GO:0008152 | metabolic process | No |
| GO:0006811 | ion transport | No |
| GO:0019693 | ribose phosphate metabolic process | No |
| GO:0009152 | purine ribonucleotide biosynthetic process | No |
| GO:0044271 | cellular nitrogen compound biosynthetic process | No |
| GO:0006812 | cation transport | No |
| GO:0009205 | purine ribonucleoside triphosphate metabolic process | No |
| GO:0055086 | nucleobase-containing small molecule metabolic process | No |
| GO:0043167 | ion binding | No |
| GO:0006793 | phosphorus metabolic process | No |
| GO:0009144 | purine nucleoside triphosphate metabolic process | No |
| GO:0019637 | organophosphate metabolic process | No |
| GO:0008150 | biological_process | No |
| GO:0044281 | small molecule metabolic process | No |
| GO:0017076 | purine nucleotide binding | No |
| GO:0009058 | biosynthetic process | No |
| GO:0006163 | purine nucleotide metabolic process | No |
| GO:0046390 | ribose phosphate biosynthetic process | No |
| GO:0072522 | purine-containing compound biosynthetic process | No |
| GO:0090407 | organophosphate biosynthetic process | No |
| GO:0034654 | nucleobase-containing compound biosynthetic process | No |
| GO:1901137 | carbohydrate derivative biosynthetic process | No |
| GO:0006796 | phosphate-containing compound metabolic process | No |
| GO:1901576 | organic substance biosynthetic process | No |
| GO:0006725 | cellular aromatic compound metabolic process | No |
| GO:0035639 | purine ribonucleoside triphosphate binding | No |
| GO:0055085 | transmembrane transport | No |
| GO:0036094 | small molecule binding | No |
| GO:0044249 | cellular biosynthetic process | No |
| GO:0034641 | cellular nitrogen compound metabolic process | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0009142 | nucleoside triphosphate biosynthetic process | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0032555 | purine ribonucleotide binding | No |
| GO:0044238 | primary metabolic process | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0051179 | localization | No |
| GO:0098662 | inorganic cation transmembrane transport | No |
| GO:0051234 | establishment of localization | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0006164 | purine nucleotide biosynthetic process | No |
| GO:0009145 | purine nucleoside triphosphate biosynthetic process | No |
| GO:0009201 | ribonucleoside triphosphate biosynthetic process | No |
| GO:0009165 | nucleotide biosynthetic process | No |
| GO:0032559 | adenyl ribonucleotide binding | No |
| GO:0030554 | adenyl nucleotide binding | No |
| GO:0009206 | purine ribonucleoside triphosphate biosynthetic process | No |
| GO:0009117 | nucleotide metabolic process | No |
| GO:0018130 | heterocycle biosynthetic process | No |
| GO:0003674 | molecular_function | No |
| GO:1901135 | carbohydrate derivative metabolic process | No |
| GO:0006753 | nucleoside phosphate metabolic process | No |
| GO:0009150 | purine ribonucleotide metabolic process | No |
| GO:1901293 | nucleoside phosphate biosynthetic process | No |
| GO:0043168 | anion binding | No |
| GO:0046483 | heterocycle metabolic process | No |
| GO:0019438 | aromatic compound biosynthetic process | No |
| GO:0009987 | cellular process | No |
| GO:0009259 | ribonucleotide metabolic process | No |
| GO:0034220 | ion transmembrane transport | No |
| GO:1901362 | organic cyclic compound biosynthetic process | No |
| GO:0006139 | nucleobase-containing compound metabolic process | No |
| GO:0098660 | inorganic ion transmembrane transport | No |
| GO:0006754 | ATP biosynthetic process | No |
| GO:0072521 | purine-containing compound metabolic process | No |
| GO:0009141 | nucleoside triphosphate metabolic process | No |
| GO:0097367 | carbohydrate derivative binding | No |
| GO:1901265 | nucleoside phosphate binding | No |
| GO:1901566 | organonitrogen compound biosynthetic process | No |
| GO:0009199 | ribonucleoside triphosphate metabolic process | No |
| GO:0005488 | binding | No |
| GO:1901360 | organic cyclic compound metabolic process | No |
| GO:0000166 | nucleotide binding | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0032553 | ribonucleotide binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 32 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophun1|4447 MFRNALRQSSRAVSAAGRIAAIRNAAPAVSSFQARSYAADAKPNPTEVSSILEQRIRGVQEESGLAETGRVFDGI ARVYGLANVQAEELVEFASGVKGMCMNLEAGQVGVVLFGSDRQVREGETVKRTGAIVDVPVGPELLGRVVDGLGN PIDGKGPLNTKQKRRAMLKAPGILPRKSVNQPVQTGYKSIDAMVPIGRGQRELVIGDRQTGKTAVCLDTILNQKR WNDGNDEDKKLYCVYVAIGVKRSTVAQLCKTLEENGAMKYTTVVAATASDAAPLQYLAPFTGAAVSEYYRDNGKH ALTIFDDLTKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNKDHGGGSMTALPIIETQGGDVSAYI PTNVISITDGQIFLESELFYKGIRPAINVGLSVSRVGSAAQLKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDAS TKQTLARGERLTELLKQKQYSPMAVNEMVPLIFAGINGYLDSVPVDKVLQWESDYLAHLKSNESDLLATIDREGA ISKELEARLKDVTQSFIKSFLG* |
| Coding | >Ophun1|4447 ATGTTCCGGAACGCCCTCCGACAGTCTTCGCGCGCCGTCTCGGCTGCTGGCAGGATCGCTGCGATTCGAAATGCC GCACCCGCCGTCTCCAGCTTCCAGGCTCGTTCCTACGCCGCCGACGCCAAGCCTAACCCGACCGAGGTTTCATCC ATTCTCGAGCAGCGAATCCGCGGCGTACAGGAGGAGTCGGGCCTGGCCGAGACCGGGCGAGTCTTTGACGGTATC GCCCGTGTGTACGGTCTGGCCAATGTTCAGGCCGAGGAGCTTGTCGAGTTCGCCTCTGGCGTAAAGGGCATGTGC ATGAACCTCGAGGCCGGACAGGTTGGTGTCGTGCTGTTCGGCTCGGATCGTCAGGTCAGAGAAGGCGAGACTGTC AAGCGCACCGGTGCCATTGTCGATGTTCCGGTCGGACCTGAATTGCTGGGCCGTGTCGTCGATGGTCTGGGAAAC CCCATCGACGGCAAGGGCCCCCTCAACACGAAGCAGAAACGCCGTGCTATGCTCAAGGCCCCCGGAATCCTGCCT CGCAAATCCGTCAACCAGCCTGTACAGACGGGCTACAAGTCGATCGATGCCATGGTTCCCATCGGTCGTGGCCAG CGTGAGCTCGTCATCGGTGACCGTCAGACCGGCAAGACGGCCGTGTGCCTCGACACTATCCTCAACCAGAAGCGA TGGAACGACGGCAACGACGAGGACAAGAAGCTCTACTGTGTCTACGTCGCCATTGGCGTGAAGCGGAGTACCGTT GCGCAACTGTGCAAGACGCTCGAGGAGAACGGAGCGATGAAGTACACGACTGTGGTTGCCGCCACTGCTTCCGAC GCAGCTCCTCTTCAGTATCTGGCGCCGTTTACAGGCGCGGCTGTTTCCGAGTACTACCGAGACAATGGCAAACAC GCCCTGACCATCTTTGACGATCTCACCAAGCAAGCTGTGGCGTATCGGCAGATGTCGCTGCTTCTCCGCCGTCCC CCGGGCCGTGAGGCTTACCCCGGTGACGTCTTCTACCTGCACTCGCGTCTGCTCGAGCGCGCGGCCAAGCTCAAC AAGGACCACGGCGGCGGCTCCATGACTGCGCTGCCCATCATCGAGACGCAGGGTGGCGACGTGTCAGCCTACATC CCGACCAACGTCATCTCCATCACCGACGGGCAGATCTTCCTCGAGTCGGAGCTGTTTTACAAGGGTATCCGTCCC GCCATCAACGTCGGCTTGTCCGTGTCGCGCGTGGGATCGGCCGCGCAGCTCAAGGCCATGAAGCAAGTCGCCGGT TCGCTGAAGCTGTTCCTGGCCCAGTACCGTGAGGTGGCGGCCTTTGCCCAGTTCGGTTCGGATCTCGACGCGTCC ACCAAGCAGACGCTTGCTCGAGGCGAGCGCTTGACGGAGCTCCTCAAGCAGAAGCAGTACTCGCCCATGGCAGTC AACGAGATGGTTCCCCTCATTTTCGCCGGCATCAACGGCTACCTCGACTCGGTTCCGGTCGACAAGGTTCTGCAG TGGGAGTCGGACTACCTCGCCCACCTCAAGTCGAACGAGTCGGACCTGCTGGCGACGATTGACCGGGAGGGCGCC ATCAGCAAGGAGCTCGAGGCTCGGCTGAAGGACGTGACGCAGTCGTTTATCAAGAGCTTCCTGGGCTAG |
| Transcript | >Ophun1|4447 ATGTTCCGGAACGCCCTCCGACAGTCTTCGCGCGCCGTCTCGGCTGCTGGCAGGATCGCTGCGATTCGAAATGCC GCACCCGCCGTCTCCAGCTTCCAGGCTCGTTCCTACGCCGCCGACGCCAAGCCTAACCCGACCGAGGTTTCATCC ATTCTCGAGCAGCGAATCCGCGGCGTACAGGAGGAGTCGGGCCTGGCCGAGACCGGGCGAGTCTTTGACGGTATC GCCCGTGTGTACGGTCTGGCCAATGTTCAGGCCGAGGAGCTTGTCGAGTTCGCCTCTGGCGTAAAGGGCATGTGC ATGAACCTCGAGGCCGGACAGGTTGGTGTCGTGCTGTTCGGCTCGGATCGTCAGGTCAGAGAAGGCGAGACTGTC AAGCGCACCGGTGCCATTGTCGATGTTCCGGTCGGACCTGAATTGCTGGGCCGTGTCGTCGATGGTCTGGGAAAC CCCATCGACGGCAAGGGCCCCCTCAACACGAAGCAGAAACGCCGTGCTATGCTCAAGGCCCCCGGAATCCTGCCT CGCAAATCCGTCAACCAGCCTGTACAGACGGGCTACAAGTCGATCGATGCCATGGTTCCCATCGGTCGTGGCCAG CGTGAGCTCGTCATCGGTGACCGTCAGACCGGCAAGACGGCCGTGTGCCTCGACACTATCCTCAACCAGAAGCGA TGGAACGACGGCAACGACGAGGACAAGAAGCTCTACTGTGTCTACGTCGCCATTGGCGTGAAGCGGAGTACCGTT GCGCAACTGTGCAAGACGCTCGAGGAGAACGGAGCGATGAAGTACACGACTGTGGTTGCCGCCACTGCTTCCGAC GCAGCTCCTCTTCAGTATCTGGCGCCGTTTACAGGCGCGGCTGTTTCCGAGTACTACCGAGACAATGGCAAACAC GCCCTGACCATCTTTGACGATCTCACCAAGCAAGCTGTGGCGTATCGGCAGATGTCGCTGCTTCTCCGCCGTCCC CCGGGCCGTGAGGCTTACCCCGGTGACGTCTTCTACCTGCACTCGCGTCTGCTCGAGCGCGCGGCCAAGCTCAAC AAGGACCACGGCGGCGGCTCCATGACTGCGCTGCCCATCATCGAGACGCAGGGTGGCGACGTGTCAGCCTACATC CCGACCAACGTCATCTCCATCACCGACGGGCAGATCTTCCTCGAGTCGGAGCTGTTTTACAAGGGTATCCGTCCC GCCATCAACGTCGGCTTGTCCGTGTCGCGCGTGGGATCGGCCGCGCAGCTCAAGGCCATGAAGCAAGTCGCCGGT TCGCTGAAGCTGTTCCTGGCCCAGTACCGTGAGGTGGCGGCCTTTGCCCAGTTCGGTTCGGATCTCGACGCGTCC ACCAAGCAGACGCTTGCTCGAGGCGAGCGCTTGACGGAGCTCCTCAAGCAGAAGCAGTACTCGCCCATGGCAGTC AACGAGATGGTTCCCCTCATTTTCGCCGGCATCAACGGCTACCTCGACTCGGTTCCGGTCGACAAGGTTCTGCAG TGGGAGTCGGACTACCTCGCCCACCTCAAGTCGAACGAGTCGGACCTGCTGGCGACGATTGACCGGGAGGGCGCC ATCAGCAAGGAGCTCGAGGCTCGGCTGAAGGACGTGACGCAGTCGTTTATCAAGAGCTTCCTGGGCTAG |
| Gene | >Ophun1|4447 ATGTTCCGGAACGCCCTCCGACAGTCTTCGCGCGCCGTCTCGGCTGCTGGCAGGATCGCTGCGGTGAGTCCCTTT CGGTAGAGCTCGTGGCGGAGCTCCGAACACGTCGACGACGACCGTCGTTGTTTCGAAGCCAGCCGCCCACGTTGT CCCCAGCTGCTTCGTCGAGCTTGGAGGTCAGATATGAGATAGTCTTTGGCTGACTGCTGCTTCCTCCTCAAGATT CGAAATGCCGCACCCGCCGTCTCCAGCTTCCAGGCTCGTTCCTACGCCGCCGACGCCAAGCCTAACCCGACCGAG GTTTCATCCATTCTCGAGCAGCGAATCCGCGGCGTACAGGAGGAGTCGGGCCTGGCCGAGACCGGGCGAGTCTTG TCTGTTGGGTAGGTGCCGTTGATCCGCTCGTCAGGACGTCTGCCGCTCACATCCGTCTCCAGTGACGGTATCGCC CGTGTGTACGGTCTGGCCAATGTTCAGGCCGAGGAGCTTGTCGAGTATGTTGCCATCTTCCCAGATGGCATCTCT GGTGCTAATTACCTCTAGGTTCGCCTCTGGCGTAAAGGGCATGTGCATGAACCTCGAGGCCGGACAGGTTGGTGT CGTGCTGTTCGGCTCGGATCGTCAGGTCAGAGAAGGCGAGACTGTCAAGCGCACCGGTGCCATTGTGAGTTGACG CAGAGGAAACTGAACTCGGCTGGTCCGCTGACTCGTCCAGGTCGATGTTCCGGTCGGACCTGAATTGCTGGGCCG TGTCGTCGATGGTCTGGGAAACCCCATCGACGGCAAGGGCCCCCTCAACACGAAGCAGAAACGCCGTGCTATGCT CAAGGCCCCCGGAATCCTGCCTCGCAAATCCGTCAACCAGCCTGTACAGACGGGCTACAAGTCGATCGATGCCAT GGTTCCCATCGGTCGTGGCCAGCGTGAGCTCGTCATCGGTGACCGTCAGACCGGCAAGACGGCCGTGTGCCTCGA CACTATCCTCAACCAGAAGCGATGGAACGACGGCAACGACGAGGACAAGAAGCTCTACTGTGTCTACGTCGCCAT TGGCGTGAAGCGGAGTACCGTTGCGCAACTGTGCAAGACGCTCGAGGAGAACGGAGCGATGAAGTACACGACTGT GGTTGCCGCCACTGCTTCCGACGCAGCTCCTCTTCAGTATCTGGCGCCGTTTACAGGTCAGTTTGGTTCTATCCC TCCTGTTGCAGCTGCTGACATCCAAAAGGCGCGGCTGTTTCCGAGTACTACCGAGACAATGGCAAACACGCCCTG ACCATCTTTGACGATCTCACCAAGCAAGCTGTGGCGTATCGGCAGATGTCGCTGCTTCTCCGCCGTCCCCCGGGC CGTGAGGCTTACCCCGGTGACGTCTTCTACCTGCACTCGCGTCTGCTCGAGCGCGCGGCCAAGCTCAACAAGGAC CACGGCGGCGGCTCCATGACTGCGCTGCCCATCATCGAGACGCAGGGTGGCGACGTGTCAGCCTACATCCCGACC AACGTCATCTCCATCACCGACGGGCAGATCTTCCTCGAGTCGGAGCTGTTTTACAAGGGTATCCGTCCCGCCATC AACGTCGGCTTGTCCGTGTCGCGCGTGGGATCGGCCGCGCAGCTCAAGGCCATGAAGCAAGTCGCCGGTTCGCTG AAGCTGTTCCTGGCCCAGTACCGTGAGGTGGCGGCCTTTGCCCAGTTCGGTTCGGATCTCGACGCGTCCACCAAG CAGACGCTTGCTCGAGGCGAGCGCGTGAGTATTCGATTGGCCTCGGAACGTTGAGTGGTTGCTGACTGGCCTCGC GCAGTTGACGGAGCTCCTCAAGCAGAAGCAGTACTCGCCCATGGCAGTCAACGAGATGGTTCCCCTCATTTTCGC CGGCATCAACGGCTACCTCGACTCGGTTCCGGTCGACAAGGTTCTGCAGTGGGAGTCGGACTACCTCGCCCACCT CAAGTCGAACGAGTCGGACCTGCTGGCGACGATTGACCGGGAGGGCGCCATCAGCAAGGAGCTCGAGGCTCGGCT GAAGGACGTGACGCAGTCGTTTATCAAGAGCTTCCTGGGCTAG |