Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4441
Gene name
LocationContig_41:13425..15535
Strand-
Gene length (bp)2110
Transcript length (bp)2055
Coding sequence length (bp)2055
Protein length (aa) 685

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08144 CPL CPL (NUC119) domain 1.4E-38 432 573

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UU76|PUF6_SCHPO Pumilio homology domain family member 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=puf6 PE=1 SV=1 90 640 2.0E-93
sp|Q04373|PUF6_YEAST Pumilio homology domain family member 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF6 PE=1 SV=1 95 617 8.0E-76
sp|X1WGX5|PUM3_DANRE Pumilio homolog 3 OS=Danio rerio GN=pum3 PE=2 SV=2 12 639 1.0E-59
sp|Q562C7|PUM3_RAT Pumilio homolog 3 OS=Rattus norvegicus GN=Pum3 PE=2 SV=1 113 639 2.0E-58
sp|Q15397|PUM3_HUMAN Pumilio homolog 3 OS=Homo sapiens GN=PUM3 PE=1 SV=3 113 642 2.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UU76|PUF6_SCHPO Pumilio homology domain family member 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=puf6 PE=1 SV=1 90 640 2.0E-93
sp|Q04373|PUF6_YEAST Pumilio homology domain family member 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF6 PE=1 SV=1 95 617 8.0E-76
sp|X1WGX5|PUM3_DANRE Pumilio homolog 3 OS=Danio rerio GN=pum3 PE=2 SV=2 12 639 1.0E-59
sp|Q562C7|PUM3_RAT Pumilio homolog 3 OS=Rattus norvegicus GN=Pum3 PE=2 SV=1 113 639 2.0E-58
sp|Q15397|PUM3_HUMAN Pumilio homolog 3 OS=Homo sapiens GN=PUM3 PE=1 SV=3 113 642 2.0E-56
sp|Q8BKS9|PUM3_MOUSE Pumilio homolog 3 OS=Mus musculus GN=Pum3 PE=1 SV=2 113 639 7.0E-55
sp|Q09622|PUF12_CAEEL Pumilio domain-containing protein 12 OS=Caenorhabditis elegans GN=puf-12 PE=3 SV=1 36 426 1.0E-33
sp|O61345|PENG_DROME Protein penguin OS=Drosophila melanogaster GN=peng PE=2 SV=1 120 534 1.0E-32
sp|Q9LRZ3|PUM24_ARATH Pumilio homolog 24 OS=Arabidopsis thaliana GN=APUM24 PE=2 SV=1 88 631 1.0E-32
sp|E3WDQ9|PUM2_XENLA Pumilio homolog 2 OS=Xenopus laevis GN=pum2 PE=1 SV=1 131 301 1.0E-08
sp|Q8TB72|PUM2_HUMAN Pumilio homolog 2 OS=Homo sapiens GN=PUM2 PE=1 SV=2 144 301 3.0E-08
sp|Q80U58|PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus GN=Pum2 PE=1 SV=2 144 301 3.0E-08
sp|Q2VB19|PUM1_CHICK Pumilio homolog 1 OS=Gallus gallus GN=PUM1 PE=2 SV=1 160 301 4.0E-08
sp|Q66KI6|PUM1_XENLA Pumilio homolog 1 OS=Xenopus laevis GN=pum1 PE=1 SV=1 160 301 4.0E-08
sp|Q80U78|PUM1_MOUSE Pumilio homolog 1 OS=Mus musculus GN=Pum1 PE=1 SV=2 160 301 5.0E-07
sp|Q14671|PUM1_HUMAN Pumilio homolog 1 OS=Homo sapiens GN=PUM1 PE=1 SV=3 160 301 5.0E-07
sp|Q5R5X3|PUM1_PONAB Pumilio homolog 1 OS=Pongo abelii GN=PUM1 PE=2 SV=1 160 301 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1929
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2811
Ophiocordyceps australis map64 (Brazil) OphauB2|7776
Ophiocordyceps camponoti-floridani Ophcf2|07317
Ophiocordyceps camponoti-rufipedis Ophun1|4441 (this protein)
Ophiocordyceps kimflemingae Ophio5|8360
Ophiocordyceps subramaniannii Hirsu2|2062

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4441
MAAPNAKTGVKRKATTAGKAKPDGKAKKARLSDAKPPKQKSDDAGRGSKPDSDSDSDSDGGAKLGKNAPGKKSAA
AAAAAAGGFDRGNMTSREVHAKQKQLAQERKAAKPLADEVHRTKKIWERLRRKSQVPKEERQKLVKELFEIVSGR
CRDFVLKHDAVRAVQTAIKYSTPEQRLQIARELEGSYAELAESRYAKFLIGKLLAHNNDEIRDMVVPNFYGKVRK
LINHPEASWILDDIYRTVATKDQKAMLLREWYGPEFALREMTKDKELTADLKQILEKEPSKRGPIMKGLLEMINS
LVQKKMSGFTMLHDAMLQYFSNIQPGSDDFSEFQELIKDDESGDLLKNMAFTKSGARLSCLLLAYGSSKDRKQLL
KAYKDTMLIMSGDVYAHVVILTAYDVIDDTKLVAKAIFPELVGDEKEKVQNLVGAVNNPNARTTILYLFEGMSSA
LFPSSHRFDLETLREVHTIRESTSKKDNDVRRKELATALAPHLLTTIETAAEQLSSTAFGCQFITDVLLSEVDGK
EKALEAVAQCAAGGKTESEETEEQPHISQTPFGGRMLKSLIQGGRFDKAAGKVVPVQPPLGFAKMLYPIIEEDVM
KWATGPSSFVVVALLEAGDFDKAKALKTLLKKNRPQLEKAATEMTAEQKARDKASSDNKGGKTGKKKGEETVGNT
GSRLLLKKL*
Coding >Ophun1|4441
ATGGCAGCACCAAACGCAAAGACCGGAGTTAAGAGAAAGGCTACCACAGCGGGAAAAGCAAAGCCCGACGGCAAG
GCCAAGAAGGCCCGCCTCAGCGACGCGAAGCCGCCCAAGCAAAAGTCCGATGACGCTGGACGAGGCTCCAAACCC
GACTCCGACTCCGACTCCGACTCTGACGGGGGAGCCAAGCTCGGCAAAAATGCCCCCGGAAAGAAGAGCGCAGCG
GCAGCAGCAGCAGCAGCCGGCGGCTTCGATCGGGGCAACATGACGTCTCGCGAGGTGCATGCGAAGCAGAAGCAG
CTGGCTCAGGAGCGAAAGGCGGCCAAGCCCCTCGCCGACGAGGTCCATCGCACCAAGAAGATCTGGGAGCGACTG
CGCAGAAAGTCGCAGGTGCCCAAAGAAGAGAGGCAGAAGCTGGTCAAGGAGCTGTTCGAAATTGTCAGCGGCCGC
TGTCGGGACTTTGTCCTCAAGCACGACGCTGTCCGTGCTGTTCAGACGGCCATCAAGTACTCGACGCCCGAGCAG
CGGCTGCAGATCGCCAGGGAGCTCGAGGGCAGCTACGCGGAGCTGGCAGAGAGTCGATATGCAAAATTTCTCATT
GGAAAGCTGCTGGCTCACAACAACGACGAGATCCGCGACATGGTCGTTCCCAACTTTTACGGCAAGGTCCGCAAG
CTCATCAACCATCCCGAGGCTTCGTGGATCCTCGACGACATTTACCGCACCGTCGCCACCAAGGACCAAAAGGCA
ATGCTGCTGCGCGAGTGGTACGGGCCCGAGTTTGCCCTCCGCGAGATGACCAAGGACAAGGAGCTCACGGCGGAT
CTGAAGCAAATCCTCGAGAAGGAGCCTAGCAAGCGCGGGCCCATTATGAAGGGGCTGCTGGAGATGATTAACTCG
CTGGTGCAGAAGAAGATGTCGGGGTTTACGATGCTGCACGACGCCATGCTGCAGTACTTTTCCAACATCCAGCCC
GGGTCGGACGACTTTTCCGAGTTTCAAGAGCTCATCAAGGATGACGAGAGCGGCGATTTGCTCAAAAACATGGCA
TTTACCAAGTCAGGCGCCCGGCTGTCTTGTCTCTTGCTGGCGTACGGCTCGTCCAAGGACAGGAAACAGCTGCTC
AAGGCGTACAAGGACACCATGCTCATCATGTCCGGCGACGTATATGCCCACGTGGTGATTCTTACGGCGTACGAC
GTCATCGACGATACCAAGCTGGTAGCCAAGGCCATCTTTCCGGAACTTGTGGGCGATGAGAAGGAAAAAGTGCAA
AACCTGGTGGGTGCGGTCAACAACCCCAACGCGCGGACGACGATTCTCTACCTTTTCGAGGGCATGTCGAGCGCT
TTGTTTCCGTCCAGCCACAGGTTCGACCTCGAGACACTGAGAGAGGTGCATACGATCCGCGAGTCGACGAGCAAG
AAGGACAACGATGTGCGGCGCAAAGAGCTGGCGACAGCGCTGGCACCGCACCTGCTGACCACCATCGAGACGGCG
GCCGAGCAGCTCTCCTCGACGGCATTCGGCTGCCAATTTATCACCGACGTCCTCCTCTCCGAAGTGGACGGCAAG
GAAAAGGCGCTCGAGGCGGTGGCGCAATGTGCAGCCGGCGGGAAGACGGAGTCGGAGGAGACGGAGGAGCAACCT
CACATATCGCAGACGCCGTTCGGAGGCCGGATGCTCAAGTCCCTGATTCAGGGCGGCAGGTTCGACAAGGCGGCC
GGAAAGGTGGTGCCGGTGCAGCCGCCGCTGGGGTTCGCCAAGATGCTGTACCCCATCATCGAAGAAGACGTGATG
AAGTGGGCGACGGGCCCCAGTTCGTTCGTGGTGGTTGCTCTTTTGGAGGCGGGCGACTTTGACAAGGCCAAGGCA
CTCAAGACGCTGCTCAAGAAGAACAGACCGCAGCTGGAGAAGGCAGCCACTGAGATGACGGCAGAGCAAAAGGCG
CGGGACAAGGCTTCGTCGGACAACAAGGGGGGCAAGACGGGCAAGAAGAAGGGGGAGGAGACGGTGGGAAACACG
GGCAGCAGGCTACTGCTGAAGAAGCTATAG
Transcript >Ophun1|4441
ATGGCAGCACCAAACGCAAAGACCGGAGTTAAGAGAAAGGCTACCACAGCGGGAAAAGCAAAGCCCGACGGCAAG
GCCAAGAAGGCCCGCCTCAGCGACGCGAAGCCGCCCAAGCAAAAGTCCGATGACGCTGGACGAGGCTCCAAACCC
GACTCCGACTCCGACTCCGACTCTGACGGGGGAGCCAAGCTCGGCAAAAATGCCCCCGGAAAGAAGAGCGCAGCG
GCAGCAGCAGCAGCAGCCGGCGGCTTCGATCGGGGCAACATGACGTCTCGCGAGGTGCATGCGAAGCAGAAGCAG
CTGGCTCAGGAGCGAAAGGCGGCCAAGCCCCTCGCCGACGAGGTCCATCGCACCAAGAAGATCTGGGAGCGACTG
CGCAGAAAGTCGCAGGTGCCCAAAGAAGAGAGGCAGAAGCTGGTCAAGGAGCTGTTCGAAATTGTCAGCGGCCGC
TGTCGGGACTTTGTCCTCAAGCACGACGCTGTCCGTGCTGTTCAGACGGCCATCAAGTACTCGACGCCCGAGCAG
CGGCTGCAGATCGCCAGGGAGCTCGAGGGCAGCTACGCGGAGCTGGCAGAGAGTCGATATGCAAAATTTCTCATT
GGAAAGCTGCTGGCTCACAACAACGACGAGATCCGCGACATGGTCGTTCCCAACTTTTACGGCAAGGTCCGCAAG
CTCATCAACCATCCCGAGGCTTCGTGGATCCTCGACGACATTTACCGCACCGTCGCCACCAAGGACCAAAAGGCA
ATGCTGCTGCGCGAGTGGTACGGGCCCGAGTTTGCCCTCCGCGAGATGACCAAGGACAAGGAGCTCACGGCGGAT
CTGAAGCAAATCCTCGAGAAGGAGCCTAGCAAGCGCGGGCCCATTATGAAGGGGCTGCTGGAGATGATTAACTCG
CTGGTGCAGAAGAAGATGTCGGGGTTTACGATGCTGCACGACGCCATGCTGCAGTACTTTTCCAACATCCAGCCC
GGGTCGGACGACTTTTCCGAGTTTCAAGAGCTCATCAAGGATGACGAGAGCGGCGATTTGCTCAAAAACATGGCA
TTTACCAAGTCAGGCGCCCGGCTGTCTTGTCTCTTGCTGGCGTACGGCTCGTCCAAGGACAGGAAACAGCTGCTC
AAGGCGTACAAGGACACCATGCTCATCATGTCCGGCGACGTATATGCCCACGTGGTGATTCTTACGGCGTACGAC
GTCATCGACGATACCAAGCTGGTAGCCAAGGCCATCTTTCCGGAACTTGTGGGCGATGAGAAGGAAAAAGTGCAA
AACCTGGTGGGTGCGGTCAACAACCCCAACGCGCGGACGACGATTCTCTACCTTTTCGAGGGCATGTCGAGCGCT
TTGTTTCCGTCCAGCCACAGGTTCGACCTCGAGACACTGAGAGAGGTGCATACGATCCGCGAGTCGACGAGCAAG
AAGGACAACGATGTGCGGCGCAAAGAGCTGGCGACAGCGCTGGCACCGCACCTGCTGACCACCATCGAGACGGCG
GCCGAGCAGCTCTCCTCGACGGCATTCGGCTGCCAATTTATCACCGACGTCCTCCTCTCCGAAGTGGACGGCAAG
GAAAAGGCGCTCGAGGCGGTGGCGCAATGTGCAGCCGGCGGGAAGACGGAGTCGGAGGAGACGGAGGAGCAACCT
CACATATCGCAGACGCCGTTCGGAGGCCGGATGCTCAAGTCCCTGATTCAGGGCGGCAGGTTCGACAAGGCGGCC
GGAAAGGTGGTGCCGGTGCAGCCGCCGCTGGGGTTCGCCAAGATGCTGTACCCCATCATCGAAGAAGACGTGATG
AAGTGGGCGACGGGCCCCAGTTCGTTCGTGGTGGTTGCTCTTTTGGAGGCGGGCGACTTTGACAAGGCCAAGGCA
CTCAAGACGCTGCTCAAGAAGAACAGACCGCAGCTGGAGAAGGCAGCCACTGAGATGACGGCAGAGCAAAAGGCG
CGGGACAAGGCTTCGTCGGACAACAAGGGGGGCAAGACGGGCAAGAAGAAGGGGGAGGAGACGGTGGGAAACACG
GGCAGCAGGCTACTGCTGAAGAAGCTATAG
Gene >Ophun1|4441
ATGGCAGCACCAAACGCAAAGACCGGAGTTAAGAGAAAGGCTACCACAGCGGGAAAAGCAAAGCCCGACGGCAAG
GCCAAGAAGGCCCGCCTCAGCGACGCGAAGCCGCCCAAGCAAAAGTCCGATGACGCTGGACGAGGCTCCAAACCC
GACTCCGACTCCGACTCCGACTCTGACGGGGGAGCCAAGCTCGGCAAAAATGCCCCCGGAAAGAAGAGCGCAGCG
GCAGCAGCAGCAGCAGCCGGCGGCTTCGATCGGGGTGCGATGTCGTCCATCGGAGCAGCAGTATCTTGTCGCTAA
CATGCTTGGTGCAGGCAACATGACGTCTCGCGAGGTGCATGCGAAGCAGAAGCAGCTGGCTCAGGAGCGAAAGGC
GGCCAAGCCCCTCGCCGACGAGGTCCATCGCACCAAGAAGATCTGGGAGCGACTGCGCAGAAAGTCGCAGGTGCC
CAAAGAAGAGAGGCAGAAGCTGGTCAAGGAGCTGTTCGAAATTGTCAGCGGCCGCTGTCGGGACTTTGTCCTCAA
GCACGACGCTGTCCGTGCTGTTCAGACGGCCATCAAGTACTCGACGCCCGAGCAGCGGCTGCAGATCGCCAGGGA
GCTCGAGGGCAGCTACGCGGAGCTGGCAGAGAGTCGATATGCAAAATTTCTCATTGGAAAGCTGCTGGCTCACAA
CAACGACGAGATCCGCGACATGGTCGTTCCCAACTTTTACGGCAAGGTCCGCAAGCTCATCAACCATCCCGAGGC
TTCGTGGATCCTCGACGACATTTACCGCACCGTCGCCACCAAGGACCAAAAGGCAATGCTGCTGCGCGAGTGGTA
CGGGCCCGAGTTTGCCCTCCGCGAGATGACCAAGGACAAGGAGCTCACGGCGGATCTGAAGCAAATCCTCGAGAA
GGAGCCTAGCAAGCGCGGGCCCATTATGAAGGGGCTGCTGGAGATGATTAACTCGCTGGTGCAGAAGAAGATGTC
GGGGTTTACGATGCTGCACGACGCCATGCTGCAGTACTTTTCCAACATCCAGCCCGGGTCGGACGACTTTTCCGA
GTTTCAAGAGCTCATCAAGGATGACGAGAGCGGCGATTTGCTCAAAAACATGGCATTTACCAAGTCAGGCGCCCG
GCTGTCTTGTCTCTTGCTGGCGTACGGCTCGTCCAAGGACAGGAAACAGCTGCTCAAGGCGTACAAGGACACCAT
GCTCATCATGTCCGGCGACGTATATGCCCACGTGGTGATTCTTACGGCGTACGACGTCATCGACGATACCAAGCT
GGTAGCCAAGGCCATCTTTCCGGAACTTGTGGGCGATGAGAAGGAAAAAGTGCAAAACCTGGTGGGTGCGGTCAA
CAACCCCAACGCGCGGACGACGATTCTCTACCTTTTCGAGGGCATGTCGAGCGCTTTGTTTCCGTCCAGCCACAG
GTTCGACCTCGAGACACTGAGAGAGGTGCATACGATCCGCGAGTCGACGAGCAAGAAGGACAACGATGTGCGGCG
CAAAGAGCTGGCGACAGCGCTGGCACCGCACCTGCTGACCACCATCGAGACGGCGGCCGAGCAGCTCTCCTCGAC
GGCATTCGGCTGCCAATTTATCACCGACGTCCTCCTCTCCGAAGTGGACGGCAAGGAAAAGGCGCTCGAGGCGGT
GGCGCAATGTGCAGCCGGCGGGAAGACGGAGTCGGAGGAGACGGAGGAGCAACCTCACATATCGCAGACGCCGTT
CGGAGGCCGGATGCTCAAGTCCCTGATTCAGGGCGGCAGGTTCGACAAGGCGGCCGGAAAGGTGGTGCCGGTGCA
GCCGCCGCTGGGGTTCGCCAAGATGCTGTACCCCATCATCGAAGAAGACGTGATGAAGTGGGCGACGGGCCCCAG
TTCGTTCGTGGTGGTTGCTCTTTTGGAGGCGGGCGACTTTGACAAGGCCAAGGCACTCAAGACGCTGCTCAAGAA
GAACAGACCGCAGCTGGAGAAGGCAGCCACTGAGATGACGGCAGAGCAAAAGGCGCGGGACAAGGCTTCGTCGGA
CAACAAGGGGGGCAAGACGGGCAAGAAGAAGGGGGAGGAGACGGTGGGAAACACGGGCAGCAGGCTACTGCTGAA
GAAGCTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail