Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4438
Gene name
LocationContig_41:9712..10509
Strand-
Gene length (bp)797
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04099 Sybindin Sybindin-like family 1.2E-53 25 175
PF04628 Sedlin_N Sedlin, N-terminal conserved region 1.1E-06 102 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43041|TRS23_SCHPO Transport protein particle subunit trs23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trs23 PE=3 SV=1 27 173 2.0E-37
sp|Q54UU1|TPPC4_DICDI Trafficking protein particle complex subunit 4 OS=Dictyostelium discoideum GN=trappc4 PE=3 SV=1 24 169 1.0E-35
sp|Q2TBL9|TPPC4_BOVIN Trafficking protein particle complex subunit 4 OS=Bos taurus GN=TRAPPC4 PE=2 SV=1 47 169 3.0E-31
sp|Q69BT7|TPPC4_RAT Trafficking protein particle complex subunit 4 OS=Rattus norvegicus GN=Trappc4 PE=2 SV=1 47 169 3.0E-31
sp|Q9ES56|TPPC4_MOUSE Trafficking protein particle complex subunit 4 OS=Mus musculus GN=Trappc4 PE=1 SV=1 47 169 3.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43041|TRS23_SCHPO Transport protein particle subunit trs23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trs23 PE=3 SV=1 27 173 2.0E-37
sp|Q54UU1|TPPC4_DICDI Trafficking protein particle complex subunit 4 OS=Dictyostelium discoideum GN=trappc4 PE=3 SV=1 24 169 1.0E-35
sp|Q2TBL9|TPPC4_BOVIN Trafficking protein particle complex subunit 4 OS=Bos taurus GN=TRAPPC4 PE=2 SV=1 47 169 3.0E-31
sp|Q69BT7|TPPC4_RAT Trafficking protein particle complex subunit 4 OS=Rattus norvegicus GN=Trappc4 PE=2 SV=1 47 169 3.0E-31
sp|Q9ES56|TPPC4_MOUSE Trafficking protein particle complex subunit 4 OS=Mus musculus GN=Trappc4 PE=1 SV=1 47 169 3.0E-31
sp|Q5R9J9|TPPC4_PONAB Trafficking protein particle complex subunit 4 OS=Pongo abelii GN=TRAPPC4 PE=2 SV=1 47 169 9.0E-31
sp|Q9Y296|TPPC4_HUMAN Trafficking protein particle complex subunit 4 OS=Homo sapiens GN=TRAPPC4 PE=1 SV=1 47 169 9.0E-31
sp|Q03784|TRS23_YEAST Trafficking protein particle complex subunit 23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRS23 PE=1 SV=1 25 176 3.0E-20
sp|Q2KMM2|TPPC1_RAT Trafficking protein particle complex subunit 1 OS=Rattus norvegicus GN=Trappc1 PE=2 SV=1 24 176 9.0E-06
sp|Q5NCF2|TPPC1_MOUSE Trafficking protein particle complex subunit 1 OS=Mus musculus GN=Trappc1 PE=1 SV=1 24 176 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0030008 TRAPP complex Yes
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0051179 localization No
GO:0099023 vesicle tethering complex No
GO:0051649 establishment of localization in cell No
GO:0051234 establishment of localization No
GO:0046907 intracellular transport No
GO:0048193 Golgi vesicle transport No
GO:0051641 cellular localization No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0140535 intracellular protein-containing complex No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4438
MDGWVGGGARLRLTGLWGGVVASTVFALIIINKAGGLVYNKTFHEGGLNKISTNDYLVLAGTFHGIHAITARLNP
VKPTRPASNPPSAPNLHQRPEPSSGLEVLETENFRMQCFNTLTGTKFLLFTDTTQVNVDLTLRRIYDLYSDYVMK
NPFYSLEMPIRCEIFDRKLLSYIREINNR*
Coding >Ophun1|4438
ATGGATGGATGGGTTGGAGGTGGAGCGAGGCTGAGGCTGACTGGGCTGTGGGGCGGAGTCGTAGCCTCGACCGTC
TTCGCCCTCATCATCATCAACAAGGCCGGCGGCTTAGTCTACAACAAGACCTTTCACGAAGGCGGCCTCAACAAG
ATCAGCACAAACGACTACCTCGTTCTCGCCGGCACCTTTCACGGCATCCACGCCATCACCGCCCGCCTCAACCCC
GTCAAGCCCACGCGCCCAGCCTCGAACCCCCCGTCGGCACCCAACCTCCACCAGCGGCCGGAGCCGTCGTCGGGC
CTCGAGGTTCTAGAGACGGAGAACTTTCGCATGCAGTGCTTCAATACCCTCACAGGCACGAAATTCTTGCTCTTC
ACAGATACCACCCAGGTCAATGTCGATCTCACGCTGAGGAGGATATACGATCTGTATTCCGACTACGTCATGAAG
AATCCTTTTTACTCGCTAGAGATGCCCATCCGCTGCGAAATCTTTGACCGGAAACTGCTTTCCTACATTAGAGAG
ATCAATAATCGCTGA
Transcript >Ophun1|4438
ATGGATGGATGGGTTGGAGGTGGAGCGAGGCTGAGGCTGACTGGGCTGTGGGGCGGAGTCGTAGCCTCGACCGTC
TTCGCCCTCATCATCATCAACAAGGCCGGCGGCTTAGTCTACAACAAGACCTTTCACGAAGGCGGCCTCAACAAG
ATCAGCACAAACGACTACCTCGTTCTCGCCGGCACCTTTCACGGCATCCACGCCATCACCGCCCGCCTCAACCCC
GTCAAGCCCACGCGCCCAGCCTCGAACCCCCCGTCGGCACCCAACCTCCACCAGCGGCCGGAGCCGTCGTCGGGC
CTCGAGGTTCTAGAGACGGAGAACTTTCGCATGCAGTGCTTCAATACCCTCACAGGCACGAAATTCTTGCTCTTC
ACAGATACCACCCAGGTCAATGTCGATCTCACGCTGAGGAGGATATACGATCTGTATTCCGACTACGTCATGAAG
AATCCTTTTTACTCGCTAGAGATGCCCATCCGCTGCGAAATCTTTGACCGGAAACTGCTTTCCTACATTAGAGAG
ATCAATAATCGCTGA
Gene >Ophun1|4438
ATGGATGGATGGGTTGGAGGTGGAGCGAGGCTGAGGCTGACTGGGCTGTGGGGCGGAGTCGTAGCCTCGTTATAA
AACTGTTAGGGCGGTGGCAGCCTTGCTGGAGGCGCTGACTCACGTTGGAGCTGGACCGACTTCAACCATGATCGT
GGCCGGCTGAGAGTGAGAGGTTCGTCGCCCTCCAAGAGCGGGAATTGAAGGCTGGTTCGCCATGTGCGTTTGAGT
TCCAACTTCATTCTACAGTCGCATCATGCTCATCCTCGCTTAGGACCGTCTTCGCCCTCATCATCATCAACAAGG
CCGGCGGCTTAGTCTACAACAAGACCTTTCACGAAGGCGGCCTCAACAAGATCAGCACAAACGACTACCTCGTTC
TCGCCGGCACCTTTCACGGGTACGCAGCTCCCCCCCCCCTGTTTTGCTTTGAGCTCCCCTTGCTCACTCCCCCCA
GCATCCACGCCATCACCGCCCGCCTCAACCCCGTCAAGCCCACGCGCCCAGCCTCGAACCCCCCGTCGGCACCCA
ACCTCCACCAGCGGCCGGAGCCGTCGTCGGGCCTCGAGGTTCTAGAGACGGAGAACTTTCGCATGCAGTGCTTCA
ATACCCTCACAGGCACGAAATTCTTGCTCTTCACAGATACCACCCAGGTCAATGTCGATCTCACGCTGAGGAGGA
TATACGATCTGTATTCCGACTACGTCATGAAGAATCCTTTTTACTCGCTAGAGATGCCCATCCGCTGCGAAATCT
TTGACCGGAAACTGCTTTCCTACATTAGAGAGATCAATAATCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail