Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4433
Gene name
LocationContig_41:760..1804
Strand-
Gene length (bp)1044
Transcript length (bp)930
Coding sequence length (bp)930
Protein length (aa) 310

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01145 Band_7 SPFH domain / Band 7 family 4.0E-23 58 235

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50085|PHB2_YEAST Prohibitin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHB2 PE=1 SV=2 52 308 5.0E-132
sp|O94550|PHB2_SCHPO Prohibitin-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phb2 PE=1 SV=2 50 298 1.0E-126
sp|Q9ZNT7|PHB2_ARATH Prohibitin-2, mitochondrial OS=Arabidopsis thaliana GN=PHB2 PE=1 SV=1 25 283 1.0E-103
sp|A9UMS3|PHB2_XENTR Prohibitin-2 OS=Xenopus tropicalis GN=phb2 PE=2 SV=1 25 309 2.0E-103
sp|Q5XIH7|PHB2_RAT Prohibitin-2 OS=Rattus norvegicus GN=Phb2 PE=1 SV=1 25 309 3.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50085|PHB2_YEAST Prohibitin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHB2 PE=1 SV=2 52 308 5.0E-132
sp|O94550|PHB2_SCHPO Prohibitin-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phb2 PE=1 SV=2 50 298 1.0E-126
sp|Q9ZNT7|PHB2_ARATH Prohibitin-2, mitochondrial OS=Arabidopsis thaliana GN=PHB2 PE=1 SV=1 25 283 1.0E-103
sp|A9UMS3|PHB2_XENTR Prohibitin-2 OS=Xenopus tropicalis GN=phb2 PE=2 SV=1 25 309 2.0E-103
sp|Q5XIH7|PHB2_RAT Prohibitin-2 OS=Rattus norvegicus GN=Phb2 PE=1 SV=1 25 309 3.0E-103
sp|O35129|PHB2_MOUSE Prohibitin-2 OS=Mus musculus GN=Phb2 PE=1 SV=1 25 309 4.0E-103
sp|Q99623|PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 25 309 4.0E-103
sp|Q2HJ97|PHB2_BOVIN Prohibitin-2 OS=Bos taurus GN=PHB2 PE=2 SV=1 25 309 1.0E-102
sp|Q5RB19|PHB2_PONAB Prohibitin-2 OS=Pongo abelii GN=PHB2 PE=2 SV=1 25 309 4.0E-102
sp|Q54Q31|PHB2_DICDI Prohibitin-2 OS=Dictyostelium discoideum GN=phbB PE=3 SV=1 55 301 5.0E-102
sp|O49460|PHB1_ARATH Prohibitin-1, mitochondrial OS=Arabidopsis thaliana GN=PHB1 PE=1 SV=1 54 279 2.0E-100
sp|P50093|PHB2_CAEEL Mitochondrial prohibitin complex protein 2 OS=Caenorhabditis elegans GN=phb-2 PE=1 SV=2 55 299 6.0E-100
sp|Q9SIL6|PHB6_ARATH Prohibitin-6, mitochondrial OS=Arabidopsis thaliana GN=PHB6 PE=1 SV=1 20 279 2.0E-98
sp|Q5ZMN3|PHB2_CHICK Prohibitin-2 OS=Gallus gallus GN=PHB2 PE=2 SV=1 55 309 3.0E-98
sp|Q9FFH5|PHB7_ARATH Prohibitin-7, mitochondrial OS=Arabidopsis thaliana GN=PHB7 PE=1 SV=1 25 295 4.0E-96
sp|Q54GI9|PHB1_DICDI Prohibitin-1, mitochondrial OS=Dictyostelium discoideum GN=phbA PE=3 SV=1 43 282 4.0E-91
sp|P67779|PHB_RAT Prohibitin OS=Rattus norvegicus GN=Phb PE=1 SV=1 40 279 2.0E-88
sp|P67778|PHB_MOUSE Prohibitin OS=Mus musculus GN=Phb PE=1 SV=1 40 279 2.0E-88
sp|P35232|PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 40 279 6.0E-88
sp|Q3T165|PHB_BOVIN Prohibitin OS=Bos taurus GN=PHB PE=2 SV=1 40 279 6.0E-88
sp|Q9P7H3|PHB1_SCHPO Prohibitin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phb1 PE=3 SV=1 48 307 2.0E-87
sp|P84173|PHB_CHICK Prohibitin OS=Gallus gallus GN=PHB PE=1 SV=1 39 279 2.0E-87
sp|P40961|PHB1_YEAST Prohibitin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHB1 PE=1 SV=2 55 293 3.0E-85
sp|O04331|PHB3_ARATH Prohibitin-3, mitochondrial OS=Arabidopsis thaliana GN=PHB3 PE=1 SV=1 36 279 2.0E-84
sp|P24156|L2CC_DROME Protein l(2)37Cc OS=Drosophila melanogaster GN=l(2)37Cc PE=2 SV=2 39 279 4.0E-84
sp|Q9LK25|PHB4_ARATH Prohibitin-4, mitochondrial OS=Arabidopsis thaliana GN=PHB4 PE=1 SV=1 42 279 4.0E-83
sp|Q9BKU4|PHB1_CAEEL Mitochondrial prohibitin complex protein 1 OS=Caenorhabditis elegans GN=phb-1 PE=1 SV=1 35 279 6.0E-77
sp|Q9LY99|PHB5_ARATH Prohibitin-5, mitochondrial OS=Arabidopsis thaliana GN=PHB5 PE=3 SV=1 54 294 8.0E-59
sp|P86220|PHB_MESAU Prohibitin (Fragments) OS=Mesocricetus auratus GN=PHB PE=1 SV=1 113 225 1.0E-14
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 35 57 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup157
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5450
Ophiocordyceps australis 1348a (Ghana) OphauG2|7625
Ophiocordyceps australis map64 (Brazil) OphauB2|3014
Ophiocordyceps australis map64 (Brazil) OphauB2|5252
Ophiocordyceps camponoti-floridani Ophcf2|01279
Ophiocordyceps camponoti-floridani Ophcf2|07325
Ophiocordyceps camponoti-rufipedis Ophun1|2335
Ophiocordyceps camponoti-rufipedis Ophun1|4433 (this protein)
Ophiocordyceps kimflemingae Ophio5|1059
Ophiocordyceps kimflemingae Ophio5|8368
Ophiocordyceps subramaniannii Hirsu2|11089
Ophiocordyceps subramaniannii Hirsu2|2047

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4433
MSNWQDEARRMAARFRQMQQNSGGPGGPGKMIGSGLLSGLGACFLLGGGIALANSLFNVDGGHRAIKYRRIGGVS
KEIYSEGTHINIPWFETPIVYDVRARPRNVSSLTGTKDLQMVNITCRVLSRPQVEALPQIYRTLGADYDERVLPS
IVNEVLKSVVAQFNASQLITQREMVARLVRENLSRRAARFNILLDDVSLTHLAFSPEFTAAVEAKQVAQQEAQRA
AFVVDKARQEKQAMVVKAQGEARSAELIGEAIKKNQAYAELKKIENARLIAQQLQEAGAQNRLLLDSEGLGLNVF
EQSSSSGKN*
Coding >Ophun1|4433
ATGAGCAACTGGCAGGATGAGGCGCGGCGGATGGCCGCACGGTTCCGCCAAATGCAGCAAAACAGCGGCGGCCCG
GGCGGTCCAGGGAAGATGATCGGCAGTGGTCTCCTCAGCGGCTTGGGCGCGTGCTTTCTGCTAGGCGGGGGCATC
GCCTTGGCCAACTCGCTGTTCAACGTTGATGGCGGTCACCGGGCTATCAAGTATCGGAGGATCGGCGGCGTGAGC
AAGGAGATTTACTCTGAAGGGACGCACATCAACATCCCCTGGTTCGAGACGCCCATCGTCTACGATGTGCGGGCG
CGGCCGCGTAACGTGTCGTCCCTGACGGGCACCAAGGACCTTCAGATGGTCAACATTACCTGCCGCGTCTTGTCC
CGGCCGCAGGTCGAGGCGTTGCCGCAGATCTACCGCACGCTGGGCGCCGACTACGACGAGCGGGTTCTTCCGTCC
ATCGTCAACGAGGTGCTCAAGAGCGTCGTCGCGCAGTTCAACGCCAGTCAGCTCATCACGCAGCGTGAGATGGTG
GCTCGGCTCGTGCGAGAGAACCTGTCGCGTCGGGCGGCGCGCTTCAACATCTTGCTCGACGACGTTTCGCTGACG
CATCTCGCCTTCTCGCCCGAGTTTACGGCCGCCGTCGAAGCCAAGCAGGTGGCGCAGCAGGAGGCCCAGCGAGCG
GCCTTTGTCGTCGACAAGGCGCGGCAGGAGAAGCAGGCCATGGTGGTCAAGGCGCAGGGTGAGGCGAGGTCGGCG
GAGCTCATTGGCGAGGCCATCAAGAAGAACCAGGCGTACGCGGAGCTCAAGAAGATTGAGAACGCTCGGCTCATT
GCGCAGCAGTTGCAGGAGGCGGGTGCGCAGAACAGGCTGCTTCTGGATTCTGAGGGTCTGGGTCTCAATGTGTTT
GAGCAGTCGTCGTCGTCGGGCAAGAATTAG
Transcript >Ophun1|4433
ATGAGCAACTGGCAGGATGAGGCGCGGCGGATGGCCGCACGGTTCCGCCAAATGCAGCAAAACAGCGGCGGCCCG
GGCGGTCCAGGGAAGATGATCGGCAGTGGTCTCCTCAGCGGCTTGGGCGCGTGCTTTCTGCTAGGCGGGGGCATC
GCCTTGGCCAACTCGCTGTTCAACGTTGATGGCGGTCACCGGGCTATCAAGTATCGGAGGATCGGCGGCGTGAGC
AAGGAGATTTACTCTGAAGGGACGCACATCAACATCCCCTGGTTCGAGACGCCCATCGTCTACGATGTGCGGGCG
CGGCCGCGTAACGTGTCGTCCCTGACGGGCACCAAGGACCTTCAGATGGTCAACATTACCTGCCGCGTCTTGTCC
CGGCCGCAGGTCGAGGCGTTGCCGCAGATCTACCGCACGCTGGGCGCCGACTACGACGAGCGGGTTCTTCCGTCC
ATCGTCAACGAGGTGCTCAAGAGCGTCGTCGCGCAGTTCAACGCCAGTCAGCTCATCACGCAGCGTGAGATGGTG
GCTCGGCTCGTGCGAGAGAACCTGTCGCGTCGGGCGGCGCGCTTCAACATCTTGCTCGACGACGTTTCGCTGACG
CATCTCGCCTTCTCGCCCGAGTTTACGGCCGCCGTCGAAGCCAAGCAGGTGGCGCAGCAGGAGGCCCAGCGAGCG
GCCTTTGTCGTCGACAAGGCGCGGCAGGAGAAGCAGGCCATGGTGGTCAAGGCGCAGGGTGAGGCGAGGTCGGCG
GAGCTCATTGGCGAGGCCATCAAGAAGAACCAGGCGTACGCGGAGCTCAAGAAGATTGAGAACGCTCGGCTCATT
GCGCAGCAGTTGCAGGAGGCGGGTGCGCAGAACAGGCTGCTTCTGGATTCTGAGGGTCTGGGTCTCAATGTGTTT
GAGCAGTCGTCGTCGTCGGGCAAGAATTAG
Gene >Ophun1|4433
ATGAGCAACTGGCAGGATGAGGCGCGGCGGATGGCCGCACGGTTCCGCCAAATGCAGCAAAACAGCGGCGGCCCG
GGCGGTCCAGGGAAGATGATCGGCAGTGGTCTCCTCAGCGGCTTGGGCGCGTGCTTTCTGCTAGGCGGGGGCATC
GCCTTGGCCAACTCGCTGTTCAACGTTGATGGCGGTCACCGGGCTATCAAGTATCGGAGGATCGGCGGCGTGAGC
AAGGAGATTTACTCTGAAGGTTTGACTCGCGTCCGGAGCGAGAAGGGTAAATGAGAGGGCTGACGAGGAGTCGAT
AGGGACGCACATCAACATCCCCTGGTTCGAGACGCCCATCGTCTACGATGTGCGGGCGCGGCCGCGTAACGTGTC
GTCCCTGACGGGCACCAAGGACCTTCAGATGGTCAACATTACCTGCCGCGTCTTGTCCCGGCCGCAGGTCGAGGC
GTTGCCGCAGATCTACCGCACGCTGGGCGCCGACTACGACGAGCGGGTTCTTCCGTCCATCGTCAACGAGGTGCT
CAAGAGCGTCGTCGCGCAGTTCAACGCCAGTCAGCTCATCACGCAGCGTGAGATGGTGGCTCGGCTCGTGCGAGA
GAACCTGTCGCGTCGGGCGGCGCGCTTCAACATCTTGCTCGACGACGTTTCGCTGACGGTAGGTCTATACCCCGA
GTCCTTTAAGCGCGCGGCTGACTGTCTTGGTCTGTGTAGCATCTCGCCTTCTCGCCCGAGTTTACGGCCGCCGTC
GAAGCCAAGCAGGTGGCGCAGCAGGAGGCCCAGCGAGCGGCCTTTGTCGTCGACAAGGCGCGGCAGGAGAAGCAG
GCCATGGTGGTCAAGGCGCAGGGTGAGGCGAGGTCGGCGGAGCTCATTGGCGAGGCCATCAAGAAGAACCAGGCG
TACGCGGAGCTCAAGAAGATTGAGAACGCTCGGCTCATTGCGCAGCAGTTGCAGGAGGCGGGTGCGCAGAACAGG
CTGCTTCTGGATTCTGAGGGTCTGGGTCTCAATGTGTTTGAGCAGTCGTCGTCGTCGGGCAAGAATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail