Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|443
Gene name
LocationContig_1121:211..3173
Strand-
Gene length (bp)2962
Transcript length (bp)2796
Coding sequence length (bp)2796
Protein length (aa) 932

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06741 LsmAD LsmAD domain 4.2E-27 79 150

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USW1|YHZ3_SCHPO Uncharacterized protein C21B10.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.03c PE=4 SV=1 19 189 2.0E-24
sp|P53297|PBP1_YEAST PAB1-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PBP1 PE=1 SV=1 29 188 3.0E-19
sp|Q55DE7|ATX2_DICDI Ataxin-2 homolog OS=Dictyostelium discoideum GN=atxn2 PE=3 SV=1 23 150 2.0E-18
sp|Q94AM9|CID4_ARATH Polyadenylate-binding protein-interacting protein 4 OS=Arabidopsis thaliana GN=CID4 PE=2 SV=1 29 149 2.0E-14
sp|Q8L793|CID3_ARATH Polyadenylate-binding protein-interacting protein 3 OS=Arabidopsis thaliana GN=CID3 PE=2 SV=1 42 148 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USW1|YHZ3_SCHPO Uncharacterized protein C21B10.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.03c PE=4 SV=1 19 189 2.0E-24
sp|P53297|PBP1_YEAST PAB1-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PBP1 PE=1 SV=1 29 188 3.0E-19
sp|Q55DE7|ATX2_DICDI Ataxin-2 homolog OS=Dictyostelium discoideum GN=atxn2 PE=3 SV=1 23 150 2.0E-18
sp|Q94AM9|CID4_ARATH Polyadenylate-binding protein-interacting protein 4 OS=Arabidopsis thaliana GN=CID4 PE=2 SV=1 29 149 2.0E-14
sp|Q8L793|CID3_ARATH Polyadenylate-binding protein-interacting protein 3 OS=Arabidopsis thaliana GN=CID3 PE=2 SV=1 42 148 3.0E-12
sp|O70305|ATX2_MOUSE Ataxin-2 OS=Mus musculus GN=Atxn2 PE=1 SV=1 18 170 2.0E-09
sp|Q99700|ATX2_HUMAN Ataxin-2 OS=Homo sapiens GN=ATXN2 PE=1 SV=2 18 170 4.0E-09
sp|Q29A33|ATX2_DROPS Ataxin-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Atx2 PE=3 SV=2 3 94 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2635
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2291
Ophiocordyceps australis map64 (Brazil) OphauB2|7498
Ophiocordyceps camponoti-floridani Ophcf2|06577
Ophiocordyceps camponoti-rufipedis Ophun1|443 (this protein)
Ophiocordyceps kimflemingae Ophio5|2984
Ophiocordyceps subramaniannii Hirsu2|4037

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|443
MPVPKKEGLPGGAAAKLDSRTQNGNRQGFRTDASISNSRYGERALKPWVPDTTDGVDSSLEGSSNSGPWDQFAEN
ERLFGLKTDYDENIYTTAINRSHPQFRERCAAADKKAREIERSAPATAHVAEERVMDWAGGNGDNEEDKYSGVRR
HDFPPLSTGRENRYTPPAKRAPTSQSTVKGAPVDPAIISSQIRGPSKRQAAIPDQSRAQATDVAKNGISAKSDGQ
KSKLYIEALAADAKMDKTGQHFKTLEAMFTEKGTEQPVGTAGSSSSSSSSRNPTPQEPDNAPSATSTVEHDVLQS
FKSFATQQRINAEKVRSSKARADKEVKLIELKNFANSFKLSTPVPSDLVSIIAKDPAKQKEIQAKAMKNAEEMAR
SKAEIISREKSQAIKDMHLKAAELNATTANATDVGRPARAPGAPQASGPSAPNNRHAGSRTQFNPYHAQPYRNNR
GGQQHAPPQQQPPPPQQSQQQPQQSQQQTGNLAQRLRHMEQQRFSQPPPPSSQHQTGQDMRAPPTGPANNVDTGF
NRRLSAAPSHIGAKLNPNSHEFRPGSFAVPFNPNSHPSAGSSPRAAANNVAESPATVAAQTAQLVRRKAKAVDVS
KCFMLTYIASMKPPAGRNWDDNGGLRPSYDTIPTWRQLQDDEKVDSTMHLTYKEHFERQPFANQPTNTPNPQHVM
PHMAHQHQLPFHLQHGSHNMGSRQSPHMTPMQMHAPQQGPVPHPPFGADDHRMMHSNSAQSFASPRMGQLPVAYP
GQVPYNQPVYMGPQMGQYRSFSNSPHYVPPQQGQMGAPVMMQPQFIPGPQGMVAAPPMLYHGGHGQFMPPSGPPQ
PVPGGTGYPSPGRPAAPVMVHQGSQQGQALYGMSPSVQYNQPAYGPGQPNGPMPNSGGQGGPVWQHVGTSWQQMH
QYWPQQWLGRGHGHDKSGPSQYQGQPGGEES*
Coding >Ophun1|443
ATGCCGGTCCCCAAGAAAGAAGGCTTGCCTGGTGGCGCTGCCGCCAAACTCGACAGCCGCACACAAAACGGAAAC
CGACAAGGCTTCCGTACCGACGCGTCCATCTCCAACAGCCGTTATGGCGAACGAGCTCTGAAACCTTGGGTTCCG
GACACGACTGATGGCGTCGACAGCAGTCTCGAGGGCTCGTCCAACTCTGGCCCCTGGGATCAATTTGCCGAGAAC
GAGAGATTGTTCGGTCTCAAGACGGACTATGACGAGAATATCTACACGACAGCCATCAACAGGAGCCATCCCCAG
TTCAGGGAGAGATGTGCTGCTGCGGACAAAAAAGCAAGGGAAATCGAGCGAAGCGCCCCAGCTACCGCACATGTG
GCGGAAGAGCGTGTCATGGATTGGGCCGGTGGCAACGGAGACAATGAAGAAGACAAGTACAGCGGCGTCCGAAGG
CACGATTTCCCTCCCCTTTCCACCGGCCGCGAGAATCGATACACGCCTCCGGCCAAACGTGCACCGACCAGTCAG
TCCACGGTCAAGGGTGCCCCAGTCGACCCGGCCATCATCTCTTCACAGATCAGGGGCCCTTCCAAGAGACAAGCG
GCCATACCTGATCAAAGCCGTGCACAAGCTACTGATGTCGCCAAGAACGGCATATCGGCGAAGTCCGATGGCCAG
AAATCGAAGCTCTATATCGAGGCCTTGGCTGCGGATGCCAAGATGGACAAGACTGGCCAGCACTTTAAGACCCTG
GAGGCGATGTTTACTGAAAAAGGGACGGAGCAGCCTGTTGGCACGGCAGGGTCATCATCCTCCAGCTCATCCAGC
CGCAACCCGACCCCGCAGGAGCCGGACAATGCTCCGAGCGCCACGTCGACTGTGGAGCATGACGTCCTGCAGTCA
TTCAAGTCATTCGCTACGCAGCAGAGAATCAACGCCGAGAAGGTCCGGTCGAGCAAGGCTCGAGCAGACAAGGAA
GTGAAGCTCATCGAGTTGAAAAACTTCGCCAACAGCTTCAAGCTGTCCACCCCGGTCCCGTCTGATTTGGTTTCC
ATCATTGCCAAGGACCCTGCAAAACAGAAGGAGATACAGGCCAAGGCGATGAAGAATGCCGAGGAGATGGCGAGG
TCCAAGGCCGAGATAATATCCCGCGAGAAGTCCCAGGCCATCAAGGACATGCACCTCAAGGCCGCGGAGCTCAAC
GCCACGACAGCCAACGCCACGGACGTAGGCCGTCCTGCTCGAGCCCCAGGTGCTCCGCAGGCTTCAGGCCCTTCA
GCCCCAAACAACAGACATGCCGGATCTCGCACTCAGTTCAACCCGTACCACGCACAGCCCTACAGGAACAACCGC
GGTGGCCAGCAGCACGCTCCGCCTCAGCAGCAGCCGCCGCCACCACAGCAGTCGCAGCAGCAGCCCCAACAATCG
CAGCAGCAGACAGGCAACCTGGCCCAGCGCCTTCGCCACATGGAGCAGCAGAGGTTCTCCCAGCCGCCGCCGCCG
TCGAGTCAACACCAGACCGGGCAGGATATGCGAGCGCCTCCCACGGGCCCCGCCAACAACGTCGACACTGGTTTC
AACCGGCGGCTCAGTGCGGCTCCCAGCCATATTGGGGCCAAGCTCAACCCCAATAGCCACGAGTTTCGACCCGGC
TCCTTCGCCGTGCCCTTCAACCCAAACAGCCACCCAAGCGCCGGGTCCAGTCCCCGAGCTGCGGCCAATAATGTG
GCCGAGAGCCCCGCCACTGTGGCCGCCCAGACCGCACAGCTCGTCCGCCGCAAGGCCAAGGCAGTGGACGTGTCC
AAGTGCTTCATGCTGACGTACATCGCTTCGATGAAGCCACCGGCGGGTCGCAACTGGGACGACAATGGCGGACTC
CGGCCCTCGTACGACACGATTCCTACGTGGCGGCAGCTGCAGGATGACGAGAAGGTGGATTCGACGATGCATCTC
ACCTACAAGGAACACTTTGAGCGCCAGCCCTTTGCGAACCAGCCGACGAACACGCCGAACCCTCAGCACGTCATG
CCTCACATGGCCCATCAACACCAACTGCCTTTCCACCTCCAACACGGGTCGCACAACATGGGTTCGCGTCAGTCT
CCGCACATGACTCCGATGCAGATGCACGCGCCTCAGCAGGGGCCGGTCCCTCACCCGCCGTTCGGTGCCGACGAT
CACCGAATGATGCATTCCAACTCTGCTCAGTCGTTCGCCTCGCCGCGGATGGGACAGTTGCCGGTCGCGTACCCG
GGACAGGTGCCCTACAACCAGCCCGTCTACATGGGACCTCAAATGGGGCAGTACCGCAGCTTCTCCAACAGCCCA
CACTACGTGCCGCCGCAGCAGGGGCAGATGGGAGCCCCGGTCATGATGCAGCCGCAGTTCATCCCTGGGCCACAG
GGCATGGTGGCGGCTCCTCCGATGTTGTATCACGGCGGACATGGGCAGTTCATGCCGCCTTCGGGGCCGCCGCAG
CCGGTGCCGGGCGGGACGGGCTATCCCAGCCCCGGGCGGCCCGCGGCGCCGGTCATGGTGCACCAGGGATCGCAG
CAGGGCCAGGCCTTGTACGGGATGAGCCCGAGCGTGCAGTACAACCAGCCCGCGTACGGCCCCGGACAACCCAAT
GGCCCAATGCCCAACTCGGGTGGGCAGGGGGGTCCGGTGTGGCAACACGTCGGAACAAGCTGGCAACAAATGCAC
CAGTACTGGCCGCAGCAATGGCTCGGACGGGGCCACGGGCACGACAAGAGCGGACCGTCTCAGTACCAGGGACAG
CCGGGCGGCGAGGAGAGCTGA
Transcript >Ophun1|443
ATGCCGGTCCCCAAGAAAGAAGGCTTGCCTGGTGGCGCTGCCGCCAAACTCGACAGCCGCACACAAAACGGAAAC
CGACAAGGCTTCCGTACCGACGCGTCCATCTCCAACAGCCGTTATGGCGAACGAGCTCTGAAACCTTGGGTTCCG
GACACGACTGATGGCGTCGACAGCAGTCTCGAGGGCTCGTCCAACTCTGGCCCCTGGGATCAATTTGCCGAGAAC
GAGAGATTGTTCGGTCTCAAGACGGACTATGACGAGAATATCTACACGACAGCCATCAACAGGAGCCATCCCCAG
TTCAGGGAGAGATGTGCTGCTGCGGACAAAAAAGCAAGGGAAATCGAGCGAAGCGCCCCAGCTACCGCACATGTG
GCGGAAGAGCGTGTCATGGATTGGGCCGGTGGCAACGGAGACAATGAAGAAGACAAGTACAGCGGCGTCCGAAGG
CACGATTTCCCTCCCCTTTCCACCGGCCGCGAGAATCGATACACGCCTCCGGCCAAACGTGCACCGACCAGTCAG
TCCACGGTCAAGGGTGCCCCAGTCGACCCGGCCATCATCTCTTCACAGATCAGGGGCCCTTCCAAGAGACAAGCG
GCCATACCTGATCAAAGCCGTGCACAAGCTACTGATGTCGCCAAGAACGGCATATCGGCGAAGTCCGATGGCCAG
AAATCGAAGCTCTATATCGAGGCCTTGGCTGCGGATGCCAAGATGGACAAGACTGGCCAGCACTTTAAGACCCTG
GAGGCGATGTTTACTGAAAAAGGGACGGAGCAGCCTGTTGGCACGGCAGGGTCATCATCCTCCAGCTCATCCAGC
CGCAACCCGACCCCGCAGGAGCCGGACAATGCTCCGAGCGCCACGTCGACTGTGGAGCATGACGTCCTGCAGTCA
TTCAAGTCATTCGCTACGCAGCAGAGAATCAACGCCGAGAAGGTCCGGTCGAGCAAGGCTCGAGCAGACAAGGAA
GTGAAGCTCATCGAGTTGAAAAACTTCGCCAACAGCTTCAAGCTGTCCACCCCGGTCCCGTCTGATTTGGTTTCC
ATCATTGCCAAGGACCCTGCAAAACAGAAGGAGATACAGGCCAAGGCGATGAAGAATGCCGAGGAGATGGCGAGG
TCCAAGGCCGAGATAATATCCCGCGAGAAGTCCCAGGCCATCAAGGACATGCACCTCAAGGCCGCGGAGCTCAAC
GCCACGACAGCCAACGCCACGGACGTAGGCCGTCCTGCTCGAGCCCCAGGTGCTCCGCAGGCTTCAGGCCCTTCA
GCCCCAAACAACAGACATGCCGGATCTCGCACTCAGTTCAACCCGTACCACGCACAGCCCTACAGGAACAACCGC
GGTGGCCAGCAGCACGCTCCGCCTCAGCAGCAGCCGCCGCCACCACAGCAGTCGCAGCAGCAGCCCCAACAATCG
CAGCAGCAGACAGGCAACCTGGCCCAGCGCCTTCGCCACATGGAGCAGCAGAGGTTCTCCCAGCCGCCGCCGCCG
TCGAGTCAACACCAGACCGGGCAGGATATGCGAGCGCCTCCCACGGGCCCCGCCAACAACGTCGACACTGGTTTC
AACCGGCGGCTCAGTGCGGCTCCCAGCCATATTGGGGCCAAGCTCAACCCCAATAGCCACGAGTTTCGACCCGGC
TCCTTCGCCGTGCCCTTCAACCCAAACAGCCACCCAAGCGCCGGGTCCAGTCCCCGAGCTGCGGCCAATAATGTG
GCCGAGAGCCCCGCCACTGTGGCCGCCCAGACCGCACAGCTCGTCCGCCGCAAGGCCAAGGCAGTGGACGTGTCC
AAGTGCTTCATGCTGACGTACATCGCTTCGATGAAGCCACCGGCGGGTCGCAACTGGGACGACAATGGCGGACTC
CGGCCCTCGTACGACACGATTCCTACGTGGCGGCAGCTGCAGGATGACGAGAAGGTGGATTCGACGATGCATCTC
ACCTACAAGGAACACTTTGAGCGCCAGCCCTTTGCGAACCAGCCGACGAACACGCCGAACCCTCAGCACGTCATG
CCTCACATGGCCCATCAACACCAACTGCCTTTCCACCTCCAACACGGGTCGCACAACATGGGTTCGCGTCAGTCT
CCGCACATGACTCCGATGCAGATGCACGCGCCTCAGCAGGGGCCGGTCCCTCACCCGCCGTTCGGTGCCGACGAT
CACCGAATGATGCATTCCAACTCTGCTCAGTCGTTCGCCTCGCCGCGGATGGGACAGTTGCCGGTCGCGTACCCG
GGACAGGTGCCCTACAACCAGCCCGTCTACATGGGACCTCAAATGGGGCAGTACCGCAGCTTCTCCAACAGCCCA
CACTACGTGCCGCCGCAGCAGGGGCAGATGGGAGCCCCGGTCATGATGCAGCCGCAGTTCATCCCTGGGCCACAG
GGCATGGTGGCGGCTCCTCCGATGTTGTATCACGGCGGACATGGGCAGTTCATGCCGCCTTCGGGGCCGCCGCAG
CCGGTGCCGGGCGGGACGGGCTATCCCAGCCCCGGGCGGCCCGCGGCGCCGGTCATGGTGCACCAGGGATCGCAG
CAGGGCCAGGCCTTGTACGGGATGAGCCCGAGCGTGCAGTACAACCAGCCCGCGTACGGCCCCGGACAACCCAAT
GGCCCAATGCCCAACTCGGGTGGGCAGGGGGGTCCGGTGTGGCAACACGTCGGAACAAGCTGGCAACAAATGCAC
CAGTACTGGCCGCAGCAATGGCTCGGACGGGGCCACGGGCACGACAAGAGCGGACCGTCTCAGTACCAGGGACAG
CCGGGCGGCGAGGAGAGCTGA
Gene >Ophun1|443
ATGCCGGTCCCCAAGAAAGAAGGCTTGCCTGGTGGCGCTGCCGCCAAACTCGACAGCCGCACACAAAACGGTACG
TCGCGTCAAGACATGTACTACGGGAGGCTGCGACTGACGTGTGCTTTTGCAGGAAACCGACAAGGCTTCCGTACC
GACGCGTCCATCTCCAACAGCCGTTATGGCGAACGAGCTCTGAAACCTTGGGTTCCGGACACGACTGATGGCGTC
GACAGCAGTCTCGAGGGCTCGTCCAACTCTGGCCCCTGGGATCAATTTGCCGAGAACGAGAGATTGTTCGGTCTC
AAGACGGACTATGACGAGAATATCTACACGACAGCCATCAACAGGAGCCATCCCCAGTTCAGGGAGAGATGTGCT
GCTGCGGACAAAAAAGCAAGGGAAATCGAGCGAAGCGCCCCAGCTACCGCACATGTGGCGGAAGAGCGTGTCATG
GATTGGGCCGGTGGCAACGGAGACAATGAAGAAGACAAGTTGGTGCCCCGAACCCTACCACTCCCAGATATACGG
AGTCTAACATGGCACTGCAGGTACAGCGGCGTCCGAAGGCACGATTTCCCTCCCCTTTCCACCGGCCGCGAGAAT
CGATACACGCCTCCGGCCAAACGTGCACCGACCAGTCAGTCCACGGTCAAGGGTGCCCCAGTCGACCCGGCCATC
ATCTCTTCACAGATCAGGGGCCCTTCCAAGAGACAAGCGGCCATACCTGATCAAAGCCGTGCACAAGCTACTGAT
GTCGCCAAGAACGGCATATCGGCGAAGTCCGATGGCCAGAAATCGAAGCTCTATATCGAGGCCTTGGCTGCGGAT
GCCAAGATGGACAAGACTGGCCAGCACTTTAAGACCCTGGAGGCGATGTTTACTGAAAAAGGGACGGAGCAGCCT
GTTGGCACGGCAGGGTCATCATCCTCCAGCTCATCCAGCCGCAACCCGACCCCGCAGGAGCCGGACAATGCTCCG
AGCGCCACGTCGACTGTGGAGCATGACGTCCTGCAGTCATTCAAGTCATTCGCTACGCAGCAGAGAATCAACGCC
GAGAAGGTCCGGTCGAGCAAGGCTCGAGCAGACAAGGAAGTGAAGCTCATCGAGTTGAAAAACTTCGCCAACAGC
TTCAAGCTGTCCACCCCGGTCCCGTCTGATTTGGTTTCCATCATTGCCAAGGACCCTGCAAAACAGAAGGAGATA
CAGGCCAAGGCGATGAAGAATGCCGAGGAGATGGCGAGGTCCAAGGCCGAGATAATATCCCGCGAGAAGTCCCAG
GCCATCAAGGACATGCACCTCAAGGCCGCGGAGCTCAACGCCACGACAGCCAACGCCACGGACGTAGGCCGTCCT
GCTCGAGCCCCAGGTGCTCCGCAGGCTTCAGGCCCTTCAGCCCCAAACAACAGACATGCCGGATCTCGCACTCAG
TTCAACCCGTACCACGCACAGCCCTACAGGAACAACCGCGGTGGCCAGCAGCACGCTCCGCCTCAGCAGCAGCCG
CCGCCACCACAGCAGTCGCAGCAGCAGCCCCAACAATCGCAGCAGCAGACAGGCAACCTGGCCCAGCGCCTTCGC
CACATGGAGCAGCAGAGGTTCTCCCAGCCGCCGCCGCCGTCGAGTCAACACCAGACCGGGCAGGATATGCGAGCG
CCTCCCACGGGCCCCGCCAACAACGTCGACACTGGTTTCAACCGGCGGCTCAGTGCGGCTCCCAGCCATATTGGG
GCCAAGCTCAACCCCAATAGCCACGAGTTTCGACCCGGCTCCTTCGCCGTGCCCTTCAACCCAAACAGCCACCCA
AGCGCCGGGTCCAGTCCCCGAGCTGCGGCCAATAATGTGGCCGAGAGCCCCGCCACTGTGGCCGCCCAGACCGCA
CAGCTCGTCCGCCGCAAGGCCAAGGCAGTGGACGTGTCCAAGTGCTTCATGCTGACGTACATCGCTTCGATGAAG
CCACCGGCGGGTCGCAACTGGGACGACAATGGCGGACTCCGGCCCTCGTACGACACGATTCCTACGTGGCGGCAG
CTGCAGGATGACGAGAAGGTGGATTCGACGATGCATCTCACCTACAAGGAACACTTTGAGCGCCAGCCCTTTGCG
AACCAGCCGACGAACACGCCGAACCCTCAGCACGTCATGCCTCACATGGCCCATCAACACCAACTGCCTTTCCAC
CTCCAACACGGGTCGCACAACATGGGTTCGCGTCAGTCTCCGCACATGACTCCGATGCAGATGCACGCGCCTCAG
CAGGGGCCGGTCCCTCACCCGCCGTTCGGTGCCGACGATCACCGAATGATGCATTCCAACTCTGCTCAGTCGTTC
GCCTCGCCGCGGATGGGACAGTTGCCGGTCGCGTACCCGGGACAGGTGCCCTACAACCAGCCCGTCTACATGGGA
CCTCAAATGGGGCAGTACCGCAGCTTCTCCAACAGCCCACACTACGTGCCGCCGCAGCAGGGGCAGATGGGAGCC
CCGGTCATGATGCAGCCGCAGTTCATCCCTGGGCCACAGGGCATGGTGGCGGCTCCTCCGATGTTGTATCACGGC
GGACATGGGCAGTTCATGCCGCCTTCGGGGCCGCCGCAGCCGGTGCCGGGCGGGACGGGCTATCCCAGCCCCGGG
CGGCCCGCGGCGCCGGTCATGGTGCACCAGGGATCGCAGCAGGGCCAGGCCTTGTACGGGATGAGCCCGAGCGTG
CAGTACAACCAGCCCGCGTACGGCCCCGGACAACCCAATGGCCCAAGTCAGTGATGAGTCCTCCCTGCCAGGGTT
GGGTCCGTTGCTGACCTGACCAGTGCCCAACTCGGGTGGGCAGGGGGGTCCGGTGTGGCAACACGTCGGAACAAG
CTGGCAACAAATGCACCAGTACTGGCCGCAGCAATGGCTCGGACGGGGCCACGGGCACGACAAGAGCGGACCGTC
TCAGTACCAGGGACAGCCGGGCGGCGAGGAGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail