Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4428
Gene name
LocationContig_409:35..5234
Strand-
Gene length (bp)5199
Transcript length (bp)4206
Coding sequence length (bp)4206
Protein length (aa) 1402

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.8E-49 134 438
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 2.3E-38 813 1259
PF17807 zf-UBP_var Variant UBP zinc finger 2.0E-21 526 589
PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein 6.7E-20 686 758
PF00627 UBA UBA/TS-N domain 1.0E-10 1082 1118
PF00627 UBA UBA/TS-N domain 2.2E-06 1143 1178
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 5.4E-14 935 1251
PF00355 Rieske Rieske [2Fe-2S] domain 1.8E-14 28 95
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 5.9E-10 273 348
PF14759 Reductase_C Reductase C-terminal 5.6E-06 458 527

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q11119|UBP14_SCHPO Ubiquitin carboxyl-terminal hydrolase 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp14 PE=1 SV=2 526 1265 0.0E+00
sp|P56399|UBP5_MOUSE Ubiquitin carboxyl-terminal hydrolase 5 OS=Mus musculus GN=Usp5 PE=1 SV=1 512 1251 5.0E-130
sp|P45974|UBP5_HUMAN Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens GN=USP5 PE=1 SV=2 512 1251 4.0E-129
sp|Q5R407|UBP5_PONAB Ubiquitin carboxyl-terminal hydrolase 5 OS=Pongo abelii GN=UBP5 PE=2 SV=1 512 1251 5.0E-128
sp|Q8L6Y1|UBP14_ARATH Ubiquitin carboxyl-terminal hydrolase 14 OS=Arabidopsis thaliana GN=UBP14 PE=1 SV=1 526 1251 9.0E-128
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q11119|UBP14_SCHPO Ubiquitin carboxyl-terminal hydrolase 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp14 PE=1 SV=2 526 1265 0.0E+00
sp|P56399|UBP5_MOUSE Ubiquitin carboxyl-terminal hydrolase 5 OS=Mus musculus GN=Usp5 PE=1 SV=1 512 1251 5.0E-130
sp|P45974|UBP5_HUMAN Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens GN=USP5 PE=1 SV=2 512 1251 4.0E-129
sp|Q5R407|UBP5_PONAB Ubiquitin carboxyl-terminal hydrolase 5 OS=Pongo abelii GN=UBP5 PE=2 SV=1 512 1251 5.0E-128
sp|Q8L6Y1|UBP14_ARATH Ubiquitin carboxyl-terminal hydrolase 14 OS=Arabidopsis thaliana GN=UBP14 PE=1 SV=1 526 1251 9.0E-128
sp|Q10499|AIF1_SCHPO Apoptosis-inducing factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aif1 PE=3 SV=3 3 528 7.0E-118
sp|P38237|UBP14_YEAST Ubiquitin carboxyl-terminal hydrolase 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP14 PE=1 SV=2 532 1265 2.0E-117
sp|P54201|UBPA_DICDI Ubiquitin carboxyl-terminal hydrolase A OS=Dictyostelium discoideum GN=ubpA PE=2 SV=2 526 1251 2.0E-109
sp|F1QFS9|UBP13_DANRE Ubiquitin carboxyl-terminal hydrolase 13 OS=Danio rerio GN=usp13 PE=2 SV=1 526 1251 7.0E-108
sp|Q92995|UBP13_HUMAN Ubiquitin carboxyl-terminal hydrolase 13 OS=Homo sapiens GN=USP13 PE=1 SV=2 526 1251 3.0E-106
sp|E1BMF7|UBP13_BOVIN Ubiquitin carboxyl-terminal hydrolase 13 OS=Bos taurus GN=USP13 PE=3 SV=2 526 1251 4.0E-106
sp|E1BY77|UBP13_CHICK Ubiquitin carboxyl-terminal hydrolase 13 OS=Gallus gallus GN=USP13 PE=3 SV=1 526 1251 3.0E-105
sp|Q5BKP2|UBP13_MOUSE Ubiquitin carboxyl-terminal hydrolase 13 OS=Mus musculus GN=Usp13 PE=1 SV=1 526 1251 2.0E-104
sp|Q96NN9|AIFM3_HUMAN Apoptosis-inducing factor 3 OS=Homo sapiens GN=AIFM3 PE=1 SV=1 15 519 7.0E-98
sp|Q3TY86|AIFM3_MOUSE Apoptosis-inducing factor 3 OS=Mus musculus GN=Aifm3 PE=1 SV=1 15 519 8.0E-95
sp|F6V6I0|UBP13_XENTR Ubiquitin carboxyl-terminal hydrolase 13 OS=Xenopus tropicalis GN=usp13 PE=3 SV=2 526 1251 5.0E-82
sp|P16640|CAMA_PSEPU Putidaredoxin reductase OS=Pseudomonas putida GN=camA PE=1 SV=1 131 520 2.0E-35
sp|Q07946|BEDA_PSEPU Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase subunit OS=Pseudomonas putida GN=bedA PE=1 SV=1 134 486 3.0E-34
sp|P37337|BPHG_BURXL Biphenyl dioxygenase system ferredoxin--NAD(+) reductase component OS=Burkholderia xenovorans (strain LB400) GN=bphG PE=3 SV=2 132 485 2.0E-32
sp|P43494|THCD_RHOER Rhodocoxin reductase OS=Rhodococcus erythropolis GN=thcD PE=1 SV=2 134 531 6.0E-32
sp|Q84BZ0|ANDAA_BURCE Anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Burkholderia cepacia GN=andAa PE=1 SV=1 132 508 2.0E-31
sp|P92947|MDAR5_ARATH Monodehydroascorbate reductase 5, mitochondrial OS=Arabidopsis thaliana GN=MDAR5 PE=1 SV=3 157 476 1.0E-30
sp|Q9LK94|MDAR4_ARATH Monodehydroascorbate reductase 4, peroxisomal OS=Arabidopsis thaliana GN=MDAR4 PE=1 SV=1 157 496 3.0E-29
sp|Q40977|MDAR_PEA Monodehydroascorbate reductase OS=Pisum sativum PE=1 SV=1 135 510 8.0E-29
sp|A5W4E9|TODA_PSEP1 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todA PE=1 SV=1 134 506 1.0E-28
sp|D5IGG6|FDR_SPHSX Ferredoxin--NAD(P)(+) reductase fdr OS=Sphingomonas sp. GN=fdr PE=1 SV=1 134 503 1.0E-28
sp|Q9SR59|MDAR3_ARATH Monodehydroascorbate reductase 3 OS=Arabidopsis thaliana GN=MDAR3 PE=2 SV=1 150 503 4.0E-28
sp|Q9L4M8|RURE_PSEPU Rubredoxin-NAD(+) reductase OS=Pseudomonas putida GN=alkT PE=3 SV=1 133 508 5.0E-28
sp|Q93WJ8|MDAR2_ARATH Monodehydroascorbate reductase 2 OS=Arabidopsis thaliana GN=MDAR2 PE=2 SV=1 153 510 2.0E-27
sp|P17052|RURE_PSEOL Rubredoxin-NAD(+) reductase OS=Pseudomonas oleovorans GN=alkT PE=1 SV=1 133 518 1.0E-26
sp|Q43497|MDAR_SOLLC Monodehydroascorbate reductase OS=Solanum lycopersicum GN=AFRR PE=1 SV=1 135 501 1.0E-25
sp|P0C621|TODA_PSEPU Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida GN=todA PE=3 SV=1 134 376 1.0E-25
sp|P08087|BNZD_PSEPU Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida GN=bnzD PE=3 SV=3 134 376 1.0E-25
sp|Q9LFA3|MDAR1_ARATH Monodehydroascorbate reductase 1, peroxisomal OS=Arabidopsis thaliana GN=MDAR1 PE=1 SV=1 135 501 3.0E-25
sp|P33009|TERPA_PSESP Terpredoxin reductase OS=Pseudomonas sp. GN=terPA PE=4 SV=1 128 508 3.0E-25
sp|B5Z115|HCAD_ECO5E 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hcaD PE=3 SV=1 130 507 7.0E-24
sp|Q8XA71|HCAD_ECO57 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O157:H7 GN=hcaD PE=3 SV=1 130 507 7.0E-24
sp|B1LNJ8|HCAD_ECOSM 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hcaD PE=3 SV=1 130 506 4.0E-23
sp|Q42711|MDARS_CUCSA Monodehydroascorbate reductase, seedling isozyme OS=Cucumis sativus PE=2 SV=1 146 501 1.0E-22
sp|B7NRJ1|HCAD_ECO7I 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hcaD PE=3 SV=1 130 506 2.0E-22
sp|B7N6C9|HCAD_ECOLU 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hcaD PE=3 SV=1 130 506 5.0E-22
sp|P77650|HCAD_ECOLI 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12) GN=hcaD PE=1 SV=1 130 506 2.0E-21
sp|B1IVT5|HCAD_ECOLC 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=hcaD PE=3 SV=1 130 506 2.0E-21
sp|A8A348|HCAD_ECOHS 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O9:H4 (strain HS) GN=hcaD PE=3 SV=1 130 506 2.0E-21
sp|B1XB17|HCAD_ECODH 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12 / DH10B) GN=hcaD PE=3 SV=1 130 506 2.0E-21
sp|C4ZXB7|HCAD_ECOBW 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hcaD PE=3 SV=1 130 506 2.0E-21
sp|B6I5B5|HCAD_ECOSE 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain SE11) GN=hcaD PE=3 SV=1 130 506 3.0E-21
sp|B7LDD4|HCAD_ECO55 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain 55989 / EAEC) GN=hcaD PE=3 SV=1 130 506 3.0E-21
sp|A7ZPY5|HCAD_ECO24 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hcaD PE=3 SV=1 130 506 4.0E-21
sp|Q3YZ11|HCAD_SHISS 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Shigella sonnei (strain Ss046) GN=hcaD PE=3 SV=1 130 506 1.0E-20
sp|Q9GRX6|AIFM1_DICDI Apoptosis-inducing factor 1, mitochondrial OS=Dictyostelium discoideum GN=aif PE=2 SV=1 130 462 3.0E-20
sp|P42435|NASD_BACSU Nitrite reductase [NAD(P)H] OS=Bacillus subtilis (strain 168) GN=nasD PE=2 SV=1 129 374 3.0E-20
sp|Q0S032|BPHA4_RHOJR Biphenyl 2,3-dioxygenase, ferredoxin reductase component OS=Rhodococcus jostii (strain RHA1) GN=bphA4 PE=1 SV=1 148 519 6.0E-20
sp|A0KEJ2|NORW_AERHH Nitric oxide reductase FlRd-NAD(+) reductase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=norW PE=3 SV=1 134 414 3.0E-19
sp|Q58065|NAOX_METJA Putative NADH oxidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0649 PE=3 SV=2 135 410 5.0E-19
sp|Q9AL95|NROR_CLOAB NADH-rubredoxin oxidoreductase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=nroR PE=1 SV=1 130 507 5.0E-19
sp|A4STH3|NORW_AERS4 Nitric oxide reductase FlRd-NAD(+) reductase OS=Aeromonas salmonicida (strain A449) GN=norW PE=3 SV=1 123 414 7.0E-19
sp|Q0T1X7|HCAD_SHIF8 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Shigella flexneri serotype 5b (strain 8401) GN=hcaD PE=3 SV=1 130 507 1.0E-18
sp|Q7N4V5|HCAD_PHOLL 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hcaD PE=3 SV=1 150 519 2.0E-18
sp|Q8L3B0|PADH_AZOEV NADH-dependent phenylglyoxylate dehydrogenase subunit epsilon OS=Azoarcus evansii GN=padH PE=1 SV=1 135 398 1.0E-16
sp|P42433|NASB_BACSU Assimilatory nitrate reductase electron transfer subunit OS=Bacillus subtilis (strain 168) GN=nasB PE=2 SV=2 130 414 1.0E-16
sp|P42454|RURE_ACIAD Rubredoxin-NAD(+) reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rubB PE=1 SV=2 134 412 2.0E-16
sp|Q9VQ79|AIFM1_DROME Putative apoptosis-inducing factor 1, mitochondrial OS=Drosophila melanogaster GN=AIF PE=2 SV=2 135 470 3.0E-15
sp|P37062|NAPE_ENTFA NADH peroxidase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=npr PE=1 SV=2 205 445 1.0E-13
sp|Q8R5K2|UBP33_MOUSE Ubiquitin carboxyl-terminal hydrolase 33 OS=Mus musculus GN=Usp33 PE=1 SV=2 664 924 2.0E-13
sp|A2RIB7|NAOX_LACLM NADH oxidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=noxE PE=1 SV=1 134 413 4.0E-13
sp|A7ZQE0|NORW_ECO24 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=norW PE=3 SV=1 132 412 7.0E-13
sp|Q8TEY7|UBP33_HUMAN Ubiquitin carboxyl-terminal hydrolase 33 OS=Homo sapiens GN=USP33 PE=1 SV=2 664 924 2.0E-12
sp|B5Z372|NORW_ECO5E Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=norW PE=3 SV=1 132 412 3.0E-12
sp|Q8X850|NORW_ECO57 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 GN=norW PE=3 SV=1 132 412 3.0E-12
sp|B2U036|NORW_SHIB3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=norW PE=3 SV=1 132 412 3.0E-12
sp|Q5REG5|UBP33_PONAB Ubiquitin carboxyl-terminal hydrolase 33 OS=Pongo abelii GN=USP33 PE=2 SV=1 664 924 4.0E-12
sp|A8A3I8|NORW_ECOHS Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O9:H4 (strain HS) GN=norW PE=3 SV=1 132 412 4.0E-12
sp|B7M9E8|NORW_ECO8A Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O8 (strain IAI1) GN=norW PE=3 SV=1 132 412 5.0E-12
sp|B7LEC2|NORW_ECO55 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain 55989 / EAEC) GN=norW PE=3 SV=1 132 412 5.0E-12
sp|A6QNM7|UBP33_BOVIN Ubiquitin carboxyl-terminal hydrolase 33 OS=Bos taurus GN=USP33 PE=2 SV=1 662 924 5.0E-12
sp|Q31X75|NORW_SHIBS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 4 (strain Sb227) GN=norW PE=3 SV=2 132 412 5.0E-12
sp|B6I697|NORW_ECOSE Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SE11) GN=norW PE=3 SV=1 132 412 7.0E-12
sp|Q0TEG9|NORW_ECOL5 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=norW PE=3 SV=1 132 412 8.0E-12
sp|P37596|NORW_ECOLI Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12) GN=norW PE=1 SV=3 132 412 9.0E-12
sp|B1IUW8|NORW_ECOLC Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=norW PE=3 SV=1 132 412 9.0E-12
sp|B1XCN8|NORW_ECODH Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / DH10B) GN=norW PE=3 SV=1 132 412 9.0E-12
sp|C4ZYV6|NORW_ECOBW Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=norW PE=3 SV=1 132 412 9.0E-12
sp|A4WDR7|NORW_ENT38 Nitric oxide reductase FlRd-NAD(+) reductase OS=Enterobacter sp. (strain 638) GN=norW PE=3 SV=1 133 436 1.0E-11
sp|Q9VVR1|NOT_DROME Ubiquitin carboxyl-terminal hydrolase nonstop OS=Drosophila melanogaster GN=not PE=1 SV=3 694 1063 1.0E-11
sp|Q8FEN4|NORW_ECOL6 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=norW PE=3 SV=1 132 412 2.0E-11
sp|Q4L4Y7|CDR_STAHJ Coenzyme A disulfide reductase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cdr PE=3 SV=1 226 416 2.0E-11
sp|Q1R7Y9|NORW_ECOUT Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain UTI89 / UPEC) GN=norW PE=3 SV=1 132 412 2.0E-11
sp|A1AEQ1|NORW_ECOK1 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O1:K1 / APEC GN=norW PE=3 SV=1 132 412 2.0E-11
sp|B7MKI0|NORW_ECO45 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=norW PE=3 SV=1 132 412 2.0E-11
sp|B7MYL1|NORW_ECO81 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O81 (strain ED1a) GN=norW PE=3 SV=1 132 412 3.0E-11
sp|B7UHC3|NORW_ECO27 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=norW PE=3 SV=1 132 412 3.0E-11
sp|Q5JGP4|CDR_THEKO Coenzyme A disulfide reductase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1299 PE=3 SV=1 134 412 3.0E-11
sp|Q3YYF3|NORW_SHISS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella sonnei (strain Ss046) GN=norW PE=3 SV=1 132 412 3.0E-11
sp|Q09738|UBP8_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp8 PE=3 SV=1 686 1047 4.0E-11
sp|P50102|UBP8_YEAST Ubiquitin carboxyl-terminal hydrolase 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP8 PE=1 SV=1 696 1030 4.0E-11
sp|Q80U87|UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus GN=Usp8 PE=1 SV=2 804 1057 5.0E-11
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 686 1057 6.0E-11
sp|B7NSJ1|NORW_ECO7I Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=norW PE=3 SV=1 132 412 6.0E-11
sp|P59403|NORW_SHIFL Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri GN=norW PE=3 SV=1 132 412 7.0E-11
sp|Q0T1D6|NORW_SHIF8 Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri serotype 5b (strain 8401) GN=norW PE=3 SV=1 132 412 7.0E-11
sp|B7LW23|NORW_ESCF3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=norW PE=3 SV=1 132 412 9.0E-11
sp|Q32CL7|NORW_SHIDS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=norW PE=3 SV=1 132 412 1.0E-10
sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens GN=USP8 PE=1 SV=1 804 1057 1.0E-10
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 686 1057 2.0E-10
sp|E7F6T8|UBP37_DANRE Ubiquitin carboxyl-terminal hydrolase 37 OS=Danio rerio GN=usp37 PE=2 SV=1 810 1053 2.0E-10
sp|Q70EK9|UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens GN=USP51 PE=2 SV=1 686 1098 2.0E-10
sp|B7N6U1|NORW_ECOLU Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=norW PE=3 SV=1 132 410 2.0E-10
sp|Q8U1M0|CDR_PYRFU Coenzyme A disulfide reductase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1186 PE=3 SV=1 229 412 3.0E-10
sp|B1LQ29|NORW_ECOSM Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=norW PE=3 SV=1 132 412 3.0E-10
sp|Q9JM53|AIFM1_RAT Apoptosis-inducing factor 1, mitochondrial OS=Rattus norvegicus GN=Aifm1 PE=1 SV=1 135 468 4.0E-10
sp|Q9Z0X1|AIFM1_MOUSE Apoptosis-inducing factor 1, mitochondrial OS=Mus musculus GN=Aifm1 PE=1 SV=1 135 468 5.0E-10
sp|B5XVA0|NORW_KLEP3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae (strain 342) GN=norW PE=3 SV=1 132 412 5.0E-10
sp|Q8D4F7|NORW_VIBVU Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio vulnificus (strain CMCP6) GN=norW PE=3 SV=1 132 419 6.0E-10
sp|Q9UYU5|CDR_PYRAB Coenzyme A disulfide reductase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB14120 PE=3 SV=1 202 412 9.0E-10
sp|Q49WB0|CDR_STAS1 Coenzyme A disulfide reductase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cdr PE=3 SV=1 226 416 9.0E-10
sp|P22944|NIR_EMENI Nitrite reductase [NAD(P)H] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=niiA PE=3 SV=2 130 414 1.0E-09
sp|A9MFX5|NORW_SALAR Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=norW PE=3 SV=1 133 412 1.0E-09
sp|Q8C6M1|UBP20_MOUSE Ubiquitin carboxyl-terminal hydrolase 20 OS=Mus musculus GN=Usp20 PE=1 SV=1 664 921 1.0E-09
sp|A8ANR8|NORW_CITK8 Nitric oxide reductase FlRd-NAD(+) reductase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=norW PE=3 SV=1 133 436 1.0E-09
sp|D2HBJ8|UBP44_AILME Ubiquitin carboxyl-terminal hydrolase 44 OS=Ailuropoda melanoleuca GN=USP44 PE=3 SV=1 664 758 2.0E-09
sp|O95831|AIFM1_HUMAN Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens GN=AIFM1 PE=1 SV=1 135 468 2.0E-09
sp|Q7MFY7|NORW_VIBVY Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio vulnificus (strain YJ016) GN=norW PE=3 SV=1 132 419 2.0E-09
sp|P75389|NAOX_MYCPN Probable NADH oxidase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=nox PE=3 SV=1 247 409 2.0E-09
sp|Q28CN3|UBP33_XENTR Ubiquitin carboxyl-terminal hydrolase 33 OS=Xenopus tropicalis GN=usp33 PE=2 SV=2 664 924 3.0E-09
sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 661 758 3.0E-09
sp|O52582|CDR_STAA8 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain NCTC 8325) GN=cdr PE=1 SV=3 226 416 4.0E-09
sp|Q7A6H1|CDR_STAAN Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain N315) GN=cdr PE=1 SV=3 226 416 4.0E-09
sp|Q99VC0|CDR_STAAM Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cdr PE=3 SV=3 226 416 4.0E-09
sp|A7X0I7|CDR_STAA1 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=cdr PE=3 SV=1 226 416 4.0E-09
sp|P08201|NIRB_ECOLI Nitrite reductase (NADH) large subunit OS=Escherichia coli (strain K12) GN=nirB PE=3 SV=4 136 437 4.0E-09
sp|Q8NXE8|CDR_STAAW Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MW2) GN=cdr PE=3 SV=3 226 416 6.0E-09
sp|Q6GAV6|CDR_STAAS Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MSSA476) GN=cdr PE=3 SV=3 226 416 6.0E-09
sp|Q06458|NIRB_KLEOX Nitrite reductase [NAD(P)H] large subunit OS=Klebsiella oxytoca GN=nasB PE=3 SV=1 152 560 6.0E-09
sp|Q9LEW0|UBP22_ARATH Ubiquitin carboxyl-terminal hydrolase 22 OS=Arabidopsis thaliana GN=UBP22 PE=2 SV=1 677 1047 6.0E-09
sp|Q99LG0|UBP16_MOUSE Ubiquitin carboxyl-terminal hydrolase 16 OS=Mus musculus GN=Usp16 PE=1 SV=2 695 921 7.0E-09
sp|A5PMR2|UBP33_DANRE Ubiquitin carboxyl-terminal hydrolase 33 OS=Danio rerio GN=usp33 PE=2 SV=1 664 921 8.0E-09
sp|A8Z076|CDR_STAAT Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=cdr PE=3 SV=1 226 416 1.0E-08
sp|A6QFI1|CDR_STAAE Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain Newman) GN=cdr PE=3 SV=1 226 416 1.0E-08
sp|Q5HHB4|CDR_STAAC Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain COL) GN=cdr PE=3 SV=3 226 416 1.0E-08
sp|Q2FIA5|CDR_STAA3 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain USA300) GN=cdr PE=1 SV=1 226 416 1.0E-08
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 664 758 2.0E-08
sp|Q2KJ09|UBP16_RAT Ubiquitin carboxyl-terminal hydrolase 16 OS=Rattus norvegicus GN=Usp16 PE=1 SV=2 695 921 2.0E-08
sp|Q6GIB7|CDR_STAAR Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MRSA252) GN=cdr PE=3 SV=3 226 416 2.0E-08
sp|A5IRE8|CDR_STAA9 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain JH9) GN=cdr PE=3 SV=1 226 416 2.0E-08
sp|A6U077|CDR_STAA2 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain JH1) GN=cdr PE=3 SV=1 226 416 2.0E-08
sp|A6TCX6|NORW_KLEP7 Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=norW PE=3 SV=1 132 412 3.0E-08
sp|Q49408|NAOX_MYCGE Probable NADH oxidase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=nox PE=3 SV=1 195 409 3.0E-08
sp|Q9HN74|DLDH_HALSA Dihydrolipoyl dehydrogenase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=lpdA PE=3 SV=1 214 450 3.0E-08
sp|Q0V9G5|UBP44_XENTR Ubiquitin carboxyl-terminal hydrolase 44 OS=Xenopus tropicalis GN=usp44 PE=2 SV=1 661 758 4.0E-08
sp|Q5XGZ2|UP44B_XENLA Ubiquitin carboxyl-terminal hydrolase 44-B OS=Xenopus laevis GN=usp44-b PE=2 SV=1 661 758 5.0E-08
sp|Q8C0R0|UBP37_MOUSE Ubiquitin carboxyl-terminal hydrolase 37 OS=Mus musculus GN=Usp37 PE=1 SV=1 812 1047 5.0E-08
sp|Q8C2S0|UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus GN=Usp44 PE=2 SV=3 664 758 5.0E-08
sp|Q6NTR6|UP44A_XENLA Ubiquitin carboxyl-terminal hydrolase 44-A OS=Xenopus laevis GN=usp44-a PE=2 SV=1 661 758 6.0E-08
sp|Q5R5Z6|UBP20_PONAB Ubiquitin carboxyl-terminal hydrolase 20 OS=Pongo abelii GN=USP20 PE=2 SV=1 664 921 6.0E-08
sp|Q922Y1|UBXN1_MOUSE UBX domain-containing protein 1 OS=Mus musculus GN=Ubxn1 PE=1 SV=1 1082 1154 7.0E-08
sp|Q86T82|UBP37_HUMAN Ubiquitin carboxyl-terminal hydrolase 37 OS=Homo sapiens GN=USP37 PE=1 SV=2 814 1047 8.0E-08
sp|Q499N6|UBXN1_RAT UBX domain-containing protein 1 OS=Rattus norvegicus GN=Ubxn1 PE=3 SV=2 1082 1154 1.0E-07
sp|A0JM59|UBP20_XENTR Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus tropicalis GN=usp20 PE=2 SV=1 684 921 1.0E-07
sp|A7Z056|UBP20_BOVIN Ubiquitin carboxyl-terminal hydrolase 20 OS=Bos taurus GN=USP20 PE=2 SV=1 686 921 1.0E-07
sp|E2RK09|UBP37_CANLF Ubiquitin carboxyl-terminal hydrolase 37 OS=Canis lupus familiaris GN=USP37 PE=3 SV=1 814 1047 1.0E-07
sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolase 20 OS=Homo sapiens GN=USP20 PE=1 SV=2 684 921 1.0E-07
sp|Q2YWW1|CDR_STAAB Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cdr PE=3 SV=1 226 416 1.0E-07
sp|B4TF25|NORW_SALHS Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella heidelberg (strain SL476) GN=norW PE=3 SV=1 133 412 2.0E-07
sp|Q04323|UBXN1_HUMAN UBX domain-containing protein 1 OS=Homo sapiens GN=UBXN1 PE=1 SV=2 1082 1132 2.0E-07
sp|B5QV90|NORW_SALEP Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella enteritidis PT4 (strain P125109) GN=norW PE=3 SV=1 133 412 3.0E-07
sp|Q6D8S1|NORW_PECAS Nitric oxide reductase FlRd-NAD(+) reductase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=norW PE=3 SV=1 134 436 3.0E-07
sp|F1SRY5|UBP37_PIG Ubiquitin carboxyl-terminal hydrolase 37 OS=Sus scrofa GN=USP37 PE=3 SV=1 812 1047 3.0E-07
sp|B5RDG6|NORW_SALG2 Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=norW PE=3 SV=1 133 412 3.0E-07
sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 664 735 3.0E-07
sp|A9N0E0|NORW_SALPB Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=norW PE=3 SV=1 133 412 3.0E-07
sp|E1C213|UBP37_CHICK Ubiquitin carboxyl-terminal hydrolase 37 OS=Gallus gallus GN=USP37 PE=3 SV=1 812 1047 3.0E-07
sp|Q70EL2|UBP45_HUMAN Ubiquitin carboxyl-terminal hydrolase 45 OS=Homo sapiens GN=USP45 PE=1 SV=3 663 921 5.0E-07
sp|Q8ZMJ6|NORW_SALTY Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=norW PE=3 SV=1 133 412 6.0E-07
sp|F1N5V1|UBP37_BOVIN Ubiquitin carboxyl-terminal hydrolase 37 OS=Bos taurus GN=USP37 PE=3 SV=1 814 1047 7.0E-07
sp|B4TT18|NORW_SALSV Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella schwarzengrund (strain CVM19633) GN=norW PE=3 SV=1 133 412 7.0E-07
sp|Q32KW2|UBXN1_BOVIN UBX domain-containing protein 1 OS=Bos taurus GN=UBXN1 PE=2 SV=1 1082 1131 8.0E-07
sp|C0PWN3|NORW_SALPC Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi C (strain RKS4594) GN=norW PE=3 SV=1 133 412 9.0E-07
sp|Q57KT2|NORW_SALCH Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella choleraesuis (strain SC-B67) GN=norW PE=3 SV=1 133 412 9.0E-07
sp|Q5E3X0|NORW_VIBF1 Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=norW PE=3 SV=2 134 412 2.0E-06
sp|Q9Y5T5|UBP16_HUMAN Ubiquitin carboxyl-terminal hydrolase 16 OS=Homo sapiens GN=USP16 PE=1 SV=1 695 921 3.0E-06
sp|Q4R6X7|UBP16_MACFA Ubiquitin carboxyl-terminal hydrolase 16 OS=Macaca fascicularis GN=USP16 PE=2 SV=2 695 921 3.0E-06
sp|Q7N4V8|HCAC_PHOLL 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hcaC PE=3 SV=1 33 110 3.0E-06
sp|P35123|UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus GN=Usp4 PE=1 SV=3 806 921 3.0E-06
sp|D0VWY5|GASHR_MARGR Glutathione amide reductase OS=Marichromatium gracile GN=garB PE=1 SV=1 183 411 7.0E-06
sp|P21880|DLDH1_BACSU Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=pdhD PE=3 SV=1 199 473 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0051537 2 iron, 2 sulfur cluster binding Yes
GO:0016579 protein deubiquitination Yes
GO:0016491 oxidoreductase activity Yes
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0043167 ion binding No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0006508 proteolysis No
GO:0070646 protein modification by small protein removal No
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0051536 iron-sulfur cluster binding No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0046914 transition metal ion binding No
GO:0051540 metal cluster binding No
GO:0043412 macromolecule modification No
GO:0036211 protein modification process No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0016787 hydrolase activity No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0071704 organic substance metabolic process No
GO:0101005 deubiquitinase activity No
GO:0008234 cysteine-type peptidase activity No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4428
MAKEFKLKDVSSLSLAPGTKSEVEVEGLKDAKVLLVNAAGKIKAVGARCTHYGAPLKNGVLTSSGRLTCPWHGAC
FDTATGDIEDAPALDALPVFAVSERDGAVYITGDESAILNSRRNPIGACSASGGKQDGVLVIGGGSGAMGVVQGL
REQGYKGSVTVISKERYLPIDRPKLSKALITDPAKLALRDRSWFEMASIDWVEGEVSSVDFTARSVSTKDGSVIP
YGKLVLATGGAARKLPLPGFKDLNNIFTLRSVPDAKAIVDAIGEKGKKIVVIGSSFIGMEAAFATCNDNSVTVVD
MAKVPLERVLGAQVGEGIRKIAESKGVKFHMGASIEKAEPSTSDKSKVGAVCLKDGSRLEADLVILGVGVAPATE
FLQNNSALSLEKDGSLKTDDKFEVVGLKDVYALGDIATYPYHGPGGEGKPVRIEHWNVAQNSGRTAAASIANRPS
RHGLIPVFWSALGAQLRYCGHPANGWDDLVLRGDAGEAKFVAYYAKGETVVAMASMGMDPAMAQSVELMTLELSP
PKASQSVYREDCTQCFDSIDDSSGLDVCLQCFNGACTGSRPHNGLHASLWKHPLVLNIRRTRKPVVRDEPPPKMS
KLAIAAESDEDRYDTALSAKCLDCDASLDITDARLDPVVQGILKANTFARKEEVKAWEQELTSCEHILMLQQHQS
RKIQQGDLGHCSACNLRENLWLCLECGNLGCGRKQMGGVDGNSHALAHATESAHGVAVKLGSITPEGTADVYCYK
CDDERLDDQLDAHLAHWGIMLADRRKTEMSLTEMQIEQNLKWDFSMTTDDGKLLKPLFGPGLTGLKNLGNSCYLA
SIVQCLFDLPSFRERYYRPDDAPPRAEEPAADLETQLRKLADGLLSGRYSKPEDEPDASHQRGLAPAMLKHLIGR
GHPEFSTMRQQDAFELFQHLVKLITRWPHGPGLDDPTKPFRFQLEQRLQCIGCGKVRYSTHEQDSIFIDVPIEKL
GDQYKPVTLKQCLDTLTGAEKVELACSACRSSEGFTKQTLFKTFPEVLAVNANRMSVVNWVPVKVDVPVIVPDEP
FLLDGYLSKGQQASEELLPDEPEAAAAAFVPEAAALGQLEAMGFPRNRCEKALHATGNSDANTAMEWLFAHMEDA
DIDAPLDLSGASGASAADPAKIEMLGAMGFDAPRAGKALKQTGGDVERAVEWLFSHPDDTGPVEDEAEPAVKEPA
GSASLPARFQLRSIVCHKGTSIHAGHYVAFIRKQLEGQDKAQWVLFNDEKVVEAHDVDEMRKFAYQPAQRLSSVS
LSSVSEAVADEGVDAVIGGAEAPQLDVLSVGNLLGVRVSPLDGDVAVGVGVDKDVEGAVAAELGEEGDGGGDLAE
EGGDVGLNIGFGPFGLGCRRRCVLLVRGGWLGRWLGRGFGGWLRDLYLQCW*
Coding >Ophun1|4428
ATGGCAAAGGAATTCAAGCTTAAAGATGTCTCGTCTCTCTCCCTCGCCCCAGGGACCAAGAGCGAGGTCGAGGTC
GAGGGCCTCAAGGATGCCAAGGTCCTACTCGTCAATGCCGCTGGCAAGATCAAGGCCGTGGGGGCGCGTTGCACT
CATTATGGAGCGCCGCTCAAGAATGGCGTTCTGACATCTTCCGGCCGCCTGACCTGTCCATGGCACGGAGCCTGC
TTTGATACCGCTACAGGCGACATAGAAGATGCCCCGGCCCTCGACGCCCTCCCCGTCTTCGCCGTCTCCGAGCGG
GACGGCGCCGTCTACATCACCGGCGACGAGTCGGCCATCCTCAACTCCCGCCGCAATCCCATCGGGGCATGCTCC
GCCTCTGGAGGAAAGCAAGACGGCGTCCTCGTCATCGGGGGCGGTTCCGGTGCCATGGGTGTCGTTCAGGGCCTC
CGTGAACAGGGTTACAAGGGCTCAGTGACCGTCATATCCAAAGAGCGCTACCTGCCAATCGACCGGCCCAAGCTC
AGCAAGGCCCTCATCACCGACCCGGCCAAGCTGGCCCTGCGTGACAGGAGCTGGTTCGAGATGGCGTCCATCGAT
TGGGTCGAGGGCGAAGTCAGCAGCGTCGACTTCACCGCCCGCTCCGTCTCTACCAAGGATGGTAGCGTTATCCCT
TATGGCAAGCTCGTCCTCGCCACCGGAGGCGCGGCGAGAAAGCTTCCATTGCCGGGCTTCAAGGACCTCAACAAC
ATTTTTACGCTGAGGTCGGTGCCTGACGCCAAGGCCATCGTCGACGCCATCGGCGAAAAGGGCAAAAAAATTGTC
GTCATAGGGTCGTCCTTTATCGGCATGGAGGCGGCCTTTGCGACGTGCAATGACAATTCGGTAACGGTAGTCGAC
ATGGCCAAGGTGCCCCTGGAGCGCGTCCTCGGAGCACAAGTCGGTGAGGGCATTCGCAAGATTGCAGAGTCCAAG
GGCGTCAAGTTCCACATGGGCGCGAGCATCGAAAAGGCCGAGCCGTCGACTTCGGACAAGTCCAAGGTGGGCGCC
GTCTGTCTAAAGGACGGGTCGAGGCTGGAAGCCGACCTGGTCATCCTCGGCGTCGGCGTCGCTCCCGCAACCGAA
TTCCTCCAGAACAACAGCGCCCTGAGCCTGGAGAAAGATGGCTCCCTCAAGACGGACGACAAGTTTGAAGTCGTC
GGCCTCAAGGACGTATACGCCCTCGGGGATATCGCCACGTACCCGTATCACGGACCGGGAGGTGAGGGCAAGCCG
GTCCGCATCGAGCACTGGAACGTGGCGCAAAACTCGGGTCGTACGGCGGCAGCCAGCATCGCCAATCGTCCCAGC
CGTCACGGTCTGATACCGGTCTTCTGGTCTGCCCTGGGCGCGCAGCTGCGATACTGCGGCCACCCGGCCAACGGC
TGGGACGACTTGGTGCTCCGAGGCGATGCCGGCGAGGCCAAGTTCGTGGCCTATTACGCCAAGGGCGAAACGGTC
GTGGCCATGGCCAGCATGGGCATGGATCCGGCCATGGCTCAGAGCGTGGAGCTGATGACATTGGAGCTCTCCCCG
CCCAAGGCCAGCCAGTCGGTCTATCGCGAAGACTGCACCCAATGCTTCGACTCCATCGACGATTCTAGCGGCCTG
GACGTCTGCCTCCAGTGCTTCAACGGCGCCTGCACTGGCTCAAGGCCGCACAACGGCCTCCACGCAAGCCTCTGG
AAGCATCCGCTGGTGCTCAACATTCGCCGTACGCGAAAGCCCGTCGTCCGCGATGAGCCGCCGCCCAAGATGTCC
AAGCTGGCCATCGCAGCTGAGTCGGACGAGGACCGGTACGATACAGCGCTCTCTGCAAAGTGCCTCGACTGCGAC
GCCTCGCTCGACATTACCGACGCGCGGCTCGATCCCGTTGTCCAAGGCATACTCAAGGCCAACACATTTGCGCGA
AAAGAGGAGGTCAAGGCCTGGGAGCAGGAGCTGACGAGCTGCGAGCACATCCTCATGCTGCAGCAGCACCAGTCG
CGCAAGATTCAGCAGGGAGACCTCGGTCACTGCTCCGCCTGTAACTTGCGAGAGAACCTGTGGCTTTGTCTCGAA
TGCGGGAATCTCGGCTGCGGCCGCAAGCAGATGGGCGGCGTCGACGGTAACTCGCACGCCCTGGCTCACGCGACT
GAGTCGGCCCATGGCGTCGCCGTCAAGCTCGGCTCCATCACCCCGGAGGGCACCGCCGACGTCTACTGCTACAAG
TGCGACGACGAGCGTCTCGACGATCAGCTGGACGCCCATCTCGCCCACTGGGGCATCATGCTGGCCGATCGCCGC
AAGACGGAGATGAGCTTGACGGAGATGCAGATTGAGCAGAATCTCAAGTGGGACTTTAGCATGACCACCGACGAC
GGCAAGCTTCTGAAGCCCCTATTCGGTCCTGGCCTTACCGGCCTCAAGAACCTGGGCAACAGCTGCTACCTGGCC
AGCATCGTACAGTGCCTCTTTGACCTGCCATCCTTTCGAGAGCGCTATTACAGGCCCGACGACGCCCCGCCCCGA
GCCGAGGAGCCGGCGGCCGACCTGGAGACGCAGTTGCGGAAGCTTGCCGACGGCCTCCTGTCGGGGCGTTATTCC
AAGCCCGAGGACGAGCCCGATGCCAGTCACCAGAGGGGCCTGGCACCGGCTATGCTGAAGCACCTCATCGGTAGA
GGCCATCCCGAGTTCTCGACGATGCGGCAGCAGGACGCCTTTGAGCTGTTCCAGCACCTCGTCAAGCTCATCACG
CGCTGGCCGCATGGCCCCGGCCTCGACGACCCGACCAAGCCCTTCCGCTTCCAGCTCGAGCAGCGGCTGCAGTGC
ATCGGGTGCGGCAAAGTGCGCTACAGCACCCATGAGCAGGACAGCATCTTCATCGACGTGCCCATCGAGAAGCTG
GGCGACCAGTACAAGCCCGTCACGCTCAAGCAGTGCCTCGACACCTTGACGGGCGCAGAAAAGGTGGAACTGGCC
TGCTCAGCCTGCCGGAGCTCAGAGGGCTTCACCAAGCAGACTCTCTTCAAGACGTTCCCAGAAGTGCTGGCAGTC
AATGCTAACAGGATGTCCGTCGTCAACTGGGTGCCCGTCAAGGTCGACGTCCCCGTCATCGTGCCGGACGAGCCA
TTCCTCTTGGACGGCTATCTGTCCAAGGGCCAACAGGCGTCAGAGGAGCTCTTACCGGACGAACCTGAAGCGGCT
GCTGCGGCTTTTGTGCCCGAGGCGGCGGCCCTCGGTCAGCTGGAGGCAATGGGATTCCCGCGCAACCGGTGCGAA
AAGGCGCTGCACGCGACCGGAAACTCGGACGCCAATACCGCCATGGAATGGCTCTTCGCCCACATGGAGGATGCC
GACATCGACGCGCCCCTGGATCTGTCCGGCGCGTCCGGTGCCTCCGCCGCCGATCCGGCCAAGATAGAGATGCTC
GGGGCCATGGGCTTCGACGCGCCCCGTGCGGGCAAGGCGCTCAAGCAGACGGGCGGCGACGTCGAACGCGCTGTC
GAATGGCTCTTTAGCCATCCGGACGATACGGGCCCAGTCGAGGATGAGGCCGAACCGGCTGTCAAGGAGCCCGCG
GGCAGTGCGTCACTCCCTGCCCGCTTCCAGCTGCGGTCCATCGTCTGCCACAAGGGGACTAGCATCCATGCTGGG
CACTACGTGGCATTCATCCGGAAGCAACTCGAGGGGCAGGACAAGGCCCAGTGGGTGCTCTTCAACGACGAAAAG
GTTGTCGAGGCGCACGACGTCGACGAGATGCGCAAGTTTGCTTACCAACCCGCGCAACGTCTATCCTCCGTCTCA
CTGAGCTCAGTCTCCGAGGCGGTAGCTGACGAGGGTGTCGACGCGGTGATTGGCGGTGCTGAAGCCCCGCAGCTG
GACGTGCTCTCCGTTGGCAATCTCCTTGGGGTCCGAGTCTCCCCACTCGACGGGGACGTCGCTGTCGGCGTCGGC
GTAGACAAGGACGTTGAAGGTGCAGTTGCCGCTGAGCTGGGGGAGGAAGGTGACGGAGGCGGTGATCTGGCGGAA
GAGGGCGGCGATGTCGGCCTGAATATCGGCTTCGGACCGTTCGGGCTGGGATGCCGGCGGCGCTGCGTTCTCCTC
GTCCGCGGCGGTTGGCTTGGGCGCTGGCTTGGACGAGGTTTTGGGGGGTGGTTGCGAGATTTGTACCTGCAGTGT
TGGTGA
Transcript >Ophun1|4428
ATGGCAAAGGAATTCAAGCTTAAAGATGTCTCGTCTCTCTCCCTCGCCCCAGGGACCAAGAGCGAGGTCGAGGTC
GAGGGCCTCAAGGATGCCAAGGTCCTACTCGTCAATGCCGCTGGCAAGATCAAGGCCGTGGGGGCGCGTTGCACT
CATTATGGAGCGCCGCTCAAGAATGGCGTTCTGACATCTTCCGGCCGCCTGACCTGTCCATGGCACGGAGCCTGC
TTTGATACCGCTACAGGCGACATAGAAGATGCCCCGGCCCTCGACGCCCTCCCCGTCTTCGCCGTCTCCGAGCGG
GACGGCGCCGTCTACATCACCGGCGACGAGTCGGCCATCCTCAACTCCCGCCGCAATCCCATCGGGGCATGCTCC
GCCTCTGGAGGAAAGCAAGACGGCGTCCTCGTCATCGGGGGCGGTTCCGGTGCCATGGGTGTCGTTCAGGGCCTC
CGTGAACAGGGTTACAAGGGCTCAGTGACCGTCATATCCAAAGAGCGCTACCTGCCAATCGACCGGCCCAAGCTC
AGCAAGGCCCTCATCACCGACCCGGCCAAGCTGGCCCTGCGTGACAGGAGCTGGTTCGAGATGGCGTCCATCGAT
TGGGTCGAGGGCGAAGTCAGCAGCGTCGACTTCACCGCCCGCTCCGTCTCTACCAAGGATGGTAGCGTTATCCCT
TATGGCAAGCTCGTCCTCGCCACCGGAGGCGCGGCGAGAAAGCTTCCATTGCCGGGCTTCAAGGACCTCAACAAC
ATTTTTACGCTGAGGTCGGTGCCTGACGCCAAGGCCATCGTCGACGCCATCGGCGAAAAGGGCAAAAAAATTGTC
GTCATAGGGTCGTCCTTTATCGGCATGGAGGCGGCCTTTGCGACGTGCAATGACAATTCGGTAACGGTAGTCGAC
ATGGCCAAGGTGCCCCTGGAGCGCGTCCTCGGAGCACAAGTCGGTGAGGGCATTCGCAAGATTGCAGAGTCCAAG
GGCGTCAAGTTCCACATGGGCGCGAGCATCGAAAAGGCCGAGCCGTCGACTTCGGACAAGTCCAAGGTGGGCGCC
GTCTGTCTAAAGGACGGGTCGAGGCTGGAAGCCGACCTGGTCATCCTCGGCGTCGGCGTCGCTCCCGCAACCGAA
TTCCTCCAGAACAACAGCGCCCTGAGCCTGGAGAAAGATGGCTCCCTCAAGACGGACGACAAGTTTGAAGTCGTC
GGCCTCAAGGACGTATACGCCCTCGGGGATATCGCCACGTACCCGTATCACGGACCGGGAGGTGAGGGCAAGCCG
GTCCGCATCGAGCACTGGAACGTGGCGCAAAACTCGGGTCGTACGGCGGCAGCCAGCATCGCCAATCGTCCCAGC
CGTCACGGTCTGATACCGGTCTTCTGGTCTGCCCTGGGCGCGCAGCTGCGATACTGCGGCCACCCGGCCAACGGC
TGGGACGACTTGGTGCTCCGAGGCGATGCCGGCGAGGCCAAGTTCGTGGCCTATTACGCCAAGGGCGAAACGGTC
GTGGCCATGGCCAGCATGGGCATGGATCCGGCCATGGCTCAGAGCGTGGAGCTGATGACATTGGAGCTCTCCCCG
CCCAAGGCCAGCCAGTCGGTCTATCGCGAAGACTGCACCCAATGCTTCGACTCCATCGACGATTCTAGCGGCCTG
GACGTCTGCCTCCAGTGCTTCAACGGCGCCTGCACTGGCTCAAGGCCGCACAACGGCCTCCACGCAAGCCTCTGG
AAGCATCCGCTGGTGCTCAACATTCGCCGTACGCGAAAGCCCGTCGTCCGCGATGAGCCGCCGCCCAAGATGTCC
AAGCTGGCCATCGCAGCTGAGTCGGACGAGGACCGGTACGATACAGCGCTCTCTGCAAAGTGCCTCGACTGCGAC
GCCTCGCTCGACATTACCGACGCGCGGCTCGATCCCGTTGTCCAAGGCATACTCAAGGCCAACACATTTGCGCGA
AAAGAGGAGGTCAAGGCCTGGGAGCAGGAGCTGACGAGCTGCGAGCACATCCTCATGCTGCAGCAGCACCAGTCG
CGCAAGATTCAGCAGGGAGACCTCGGTCACTGCTCCGCCTGTAACTTGCGAGAGAACCTGTGGCTTTGTCTCGAA
TGCGGGAATCTCGGCTGCGGCCGCAAGCAGATGGGCGGCGTCGACGGTAACTCGCACGCCCTGGCTCACGCGACT
GAGTCGGCCCATGGCGTCGCCGTCAAGCTCGGCTCCATCACCCCGGAGGGCACCGCCGACGTCTACTGCTACAAG
TGCGACGACGAGCGTCTCGACGATCAGCTGGACGCCCATCTCGCCCACTGGGGCATCATGCTGGCCGATCGCCGC
AAGACGGAGATGAGCTTGACGGAGATGCAGATTGAGCAGAATCTCAAGTGGGACTTTAGCATGACCACCGACGAC
GGCAAGCTTCTGAAGCCCCTATTCGGTCCTGGCCTTACCGGCCTCAAGAACCTGGGCAACAGCTGCTACCTGGCC
AGCATCGTACAGTGCCTCTTTGACCTGCCATCCTTTCGAGAGCGCTATTACAGGCCCGACGACGCCCCGCCCCGA
GCCGAGGAGCCGGCGGCCGACCTGGAGACGCAGTTGCGGAAGCTTGCCGACGGCCTCCTGTCGGGGCGTTATTCC
AAGCCCGAGGACGAGCCCGATGCCAGTCACCAGAGGGGCCTGGCACCGGCTATGCTGAAGCACCTCATCGGTAGA
GGCCATCCCGAGTTCTCGACGATGCGGCAGCAGGACGCCTTTGAGCTGTTCCAGCACCTCGTCAAGCTCATCACG
CGCTGGCCGCATGGCCCCGGCCTCGACGACCCGACCAAGCCCTTCCGCTTCCAGCTCGAGCAGCGGCTGCAGTGC
ATCGGGTGCGGCAAAGTGCGCTACAGCACCCATGAGCAGGACAGCATCTTCATCGACGTGCCCATCGAGAAGCTG
GGCGACCAGTACAAGCCCGTCACGCTCAAGCAGTGCCTCGACACCTTGACGGGCGCAGAAAAGGTGGAACTGGCC
TGCTCAGCCTGCCGGAGCTCAGAGGGCTTCACCAAGCAGACTCTCTTCAAGACGTTCCCAGAAGTGCTGGCAGTC
AATGCTAACAGGATGTCCGTCGTCAACTGGGTGCCCGTCAAGGTCGACGTCCCCGTCATCGTGCCGGACGAGCCA
TTCCTCTTGGACGGCTATCTGTCCAAGGGCCAACAGGCGTCAGAGGAGCTCTTACCGGACGAACCTGAAGCGGCT
GCTGCGGCTTTTGTGCCCGAGGCGGCGGCCCTCGGTCAGCTGGAGGCAATGGGATTCCCGCGCAACCGGTGCGAA
AAGGCGCTGCACGCGACCGGAAACTCGGACGCCAATACCGCCATGGAATGGCTCTTCGCCCACATGGAGGATGCC
GACATCGACGCGCCCCTGGATCTGTCCGGCGCGTCCGGTGCCTCCGCCGCCGATCCGGCCAAGATAGAGATGCTC
GGGGCCATGGGCTTCGACGCGCCCCGTGCGGGCAAGGCGCTCAAGCAGACGGGCGGCGACGTCGAACGCGCTGTC
GAATGGCTCTTTAGCCATCCGGACGATACGGGCCCAGTCGAGGATGAGGCCGAACCGGCTGTCAAGGAGCCCGCG
GGCAGTGCGTCACTCCCTGCCCGCTTCCAGCTGCGGTCCATCGTCTGCCACAAGGGGACTAGCATCCATGCTGGG
CACTACGTGGCATTCATCCGGAAGCAACTCGAGGGGCAGGACAAGGCCCAGTGGGTGCTCTTCAACGACGAAAAG
GTTGTCGAGGCGCACGACGTCGACGAGATGCGCAAGTTTGCTTACCAACCCGCGCAACGTCTATCCTCCGTCTCA
CTGAGCTCAGTCTCCGAGGCGGTAGCTGACGAGGGTGTCGACGCGGTGATTGGCGGTGCTGAAGCCCCGCAGCTG
GACGTGCTCTCCGTTGGCAATCTCCTTGGGGTCCGAGTCTCCCCACTCGACGGGGACGTCGCTGTCGGCGTCGGC
GTAGACAAGGACGTTGAAGGTGCAGTTGCCGCTGAGCTGGGGGAGGAAGGTGACGGAGGCGGTGATCTGGCGGAA
GAGGGCGGCGATGTCGGCCTGAATATCGGCTTCGGACCGTTCGGGCTGGGATGCCGGCGGCGCTGCGTTCTCCTC
GTCCGCGGCGGTTGGCTTGGGCGCTGGCTTGGACGAGGTTTTGGGGGGTGGTTGCGAGATTTGTACCTGCAGTGT
TGGTGA
Gene >Ophun1|4428
ATGGCAAAGGAATTCAAGCTTAAAGATGTCTCGTCTCTCTCCCTCGCCCCAGGGACCAAGAGCGAGGTCGAGGTC
GAGGGCCTCAAGGATGCCAAGGTCCTACTCGTCAATGCCGCTGGCAAGATCAAGGCCGTGGGGGCGCGTTGCACT
CATTATGGAGCGCCGCTCAAGAATGGCGTTCTGACATCTTCCGGCCGCCTGACCTGTCCATGGCACGGAGGTAGG
CTGTTGAATCGTCGGATCCAGCGCCCTTTCAGCTAATCCATCCCATCTTCGTAGCCTGCTTTGATACCGCTACAG
GCGACATAGAAGATGCCCCGGCCCTCGACGCCCTCCCCGTCTTCGCCGTCTCCGAGCGGGACGGCGCCGTCTACA
TCACCGGCGACGAGTCGGCCATCCTCAACTCCCGCCGCAATCCCATCGGGGCATGCTCCGCCTCTGGAGGAAAGC
AAGACGGCGTCCTCGTCATCGGGGGCGGTTCCGGTGCCATGGGTGTCGTTCAGGGCCTCCGTGAACAGGGTTACA
AGGGCTCAGTGACCGTCATATCCAAAGAGCGCTACCTGCCAATCGACCGGCCCAAGCTCAGCAAGGCCCTCATCA
CCGACCCGGCCAAGCTGGCCCTGCGTGACAGGAGCTGGTTCGAGATGGCGTCCATCGATTGGGTCGAGGGCGAAG
TCAGCAGCGTCGACTTCACCGCCCGCTCCGTCTCTACCAAGGATGGTAGCGTTATCCCTTATGGCAAGCTCGTCC
TCGCCACCGGAGGCGCGGCGAGAAAGCTTCCATTGCCGGGCTTCAAGGACCTCAACAACATTTTTACGCTGAGGT
CGGTGCCTGACGCCAAGGCCATCGTCGACGCCATCGGCGAAAAGGGCAAAAAAATTGTCGTCATAGGGTCGTCCT
TTATCGGCATGGAGGCGGCCTTTGCGACGTGCAATGACAATTCGGTAACGGTAGTCGACATGGCCAAGGTGCCCC
TGGAGCGCGTCCTCGGAGCACAAGTCGGTGAGGGCATTCGCAAGATTGCAGAGTCCAAGGGCGTCAAGTTCCACA
TGGGCGCGAGCATCGAAAAGGCCGAGCCGTCGACTTCGGACAAGTCCAAGGTGGGCGCCGTCTGTCTAAAGGACG
GGTCGAGGCTGGAAGCCGACCTGGTCATCCTCGGCGTCGGCGTCGCTCCCGCAACCGAATTCCTCCAGAACAACA
GCGCCCTGAGCCTGGAGAAAGATGGCTCCCTCAAGACGGACGACAAGTTTGAAGTCGTCGGCCTCAAGGACGTAT
ACGCCCTCGGGGATATCGCCACGTACCCGTATCACGGACCGGGAGGTGAGGGCAAGCCGGTCCGCATCGAGCACT
GGAACGTGGCGCAAAACTCGGGTCGTACGGCGGCAGCCAGCATCGCCAATCGTCCCAGCCGTCACGGTCTGATAC
CGGTCTTCTGGTCTGCCCTGGGCGCGCAGCTGCGATACTGCGGCCACCCGGCCAACGGCTGGGACGACTTGGTGC
TCCGAGGCGATGCCGGCGAGGCCAAGTTCGTGGCCTATTACGCCAAGGGCGAAACGGTCGTGGCCATGGCCAGCA
TGGGCATGGATCCGGCCATGGCTCAGAGCGTGGAGCTGATGACATTGGGTAAGATGCCCAGCAAGAGCCAGCTGA
AGGGGGGGATGGACATAATGGACGTTGGCGTTCCAGGCGCACGGATGTAATAGTTCTCTAGGAGCTCAGGCAGGC
ATCTCGATCAGTAGAGTACCTACATACCTATGTATGTGCCAGACAGTAGTGGGTAGGTATTCGTAGTAGTTGATG
AAAAAGCTGTGGGATGCTGTAGAATCGTCGACCTACTGGTGGTTTCAAGTTCCATGTCGTTGGTTTTGGTCGGCC
GAAAGCCGGGACAAGGTACCGACTACCGGACAGCCGCCATTTCCTCCCCCCTGCAGCTGCGCGAACCTTCGTTTG
CCTTCAAGTACCCTATACCTACCTGGCCTGCTCTTCTGTTCGTCATCCACCTCGGCTACAGCTTCCTGCCCCTCC
AACGACCTCTCACCATCGACCTCTCACCATCGACCTCTCTTCCACGAACCTTGGCCTACGACAGCTGCTGCCTTA
AGACGCGGCTCTCAGATACAGAGAGCACAATGACGTGTCCTCATCTCGACTCTCTCGCCTCAGGTGCGTTCAGCC
GCAGCTCCCGCTGATACCCGCGAGACTCACGCTGCCTTCCAGAGCTCTCCCCGCCCAAGGCCAGCCAGTCGGTCT
ATCGCGAAGACTGCACCCAATGCTTCGACTCCATCGTGCGTCGGCCGCCGATGCCTTCTTGCGTCAACCATCGCT
GACATGGTCTCGACATGGTGTTAGGACGATTCTAGCGGCCTGGACGTCTGCCTCCAGTGCTTCAACGGCGCCTGC
ACTGGCTCAAGGCCGCACAACGGCCTCCACGCAAGCCTCTGGAAGCATCCGCTGGTGCTCAACATTCGCCGTACG
CGAAAGCCCGTCGTCCGCGATGAGCCGCCGCCCAAGATGTCCAAGCTGGCCATCGCAGCTGAGTCGGACGAGGAC
CGGTACGATACAGCGCTCTCTGCAAAGTGCCTCGACTGCGACGCCTCGCTCGACATTACCGACGCGCGGCTCGAT
CCCGTTGTCCAAGGCATACTCAAGGCCAACACATTTGCGCGAAAAGAGGAGGTCAAGGCCTGGGAGCAGGAGCTG
ACGAGCTGCGAGCACATCCTCATGCTGCAGCAGCACCAGTCGCGCAAGATTCAGCAGGGAGACCTCGGTCACTGC
TCCGCCTGTAACTTGCGAGAGAACCTGTGGCTTTGTCTCGAATGCGGGAATCTCGGCTGCGGCCGCAAGCAGATG
GGCGGCGTCGACGGTAACTCGCACGCCCTGGCTCACGCGACTGAGTCGGCCCATGGCGTCGCCGTCAAGCTCGGC
TCCATCACCCCGGAGGGCACCGCCGACGTCTACTGCTACAAGTGCGACGACGAGCGTCTCGACGATCAGCTGGAC
GCCCATCTCGCCCACTGGGGCATCATGCTGGCCGATCGCCGCAAGACGGAGATGAGCTTGACGGAGATGCAGATT
GAGCAGAATCTCAAGTGGGACTTTAGCATGACCACCGACGACGGCAAGCTTCTGAAGCCCCTATTCGGTCCTGGC
CTTACCGGCCTCAAGAACCTGGGCAACAGCTGCTACCTGGCCAGCATCGTACAGTGCCTCTTTGACCTGCCATCC
TTTCGAGAGCGCTATTACAGGCCCGACGACGCCCCGCCCCGAGCCGAGGAGCCGGCGGCCGACCTGGAGACGCAG
TTGCGGAAGCTTGCCGACGGCCTCCTGTCGGGGCGTTATTCCAAGCCCGAGGACGAGCCCGATGCCAGTCACCAG
AGGGGCCTGGCACCGGCTATGCTGAAGCACCTCATCGGTAGAGGCCATCCCGAGTTCTCGACGATGCGGCAGCAG
GACGCCTTTGAGCTGTTCCAGCACCTCGTCAAGCTCATCACGCGCTGGCCGCATGGCCCCGGCCTCGACGACCCG
ACCAAGCCCTTCCGCTTCCAGCTCGAGCAGCGGCTGCAGTGCATCGGGTGCGGCAAAGTGCGCTACAGCACCCAT
GAGCAGGACAGCATCTTCATCGACGTGCCCATCGAGAAGCTGGGCGACCAGTACAAGCCCGTCACGCTCAAGCAG
TGCCTCGACACCTTGACGGGCGCAGAAAAGGTGGAACTGGCCTGCTCAGCCTGCCGGAGCTCAGAGGGCTTCACC
AAGCAGACTCTCTTCAAGACGTTCCCAGAAGTGCTGGCAGTCAATGCTAACAGGATGTCCGTCGTCAACTGGGTG
CCCGTCAAGGTCGACGTCCCCGTCATCGTGCCGGACGAGCCATTCCTCTTGGACGGCTATCTGTCCAAGGGCCAA
CAGGCGTCAGAGGAGCTCTTACCGGACGAACCTGAAGCGGCTGCTGCGGCTTTTGTGCCCGAGGCGGCGGCCCTC
GGTCAGCTGGAGGCAATGGGATTCCCGCGCAACCGGTGCGAAAAGGCGCTGCACGCGACCGGAAACTCGGACGCC
AATACCGCCATGGAATGGCTCTTCGCCCACATGGAGGATGCCGACATCGACGCGCCCCTGGATCTGTCCGGCGCG
TCCGGTGCCTCCGCCGCCGATCCGGCCAAGATAGAGATGCTCGGGGCCATGGGCTTCGACGCGCCCCGTGCGGGC
AAGGCGCTCAAGCAGACGGGCGGCGACGTCGAACGCGCTGTCGAATGGCTCTTTAGCCATCCGGACGATACGGGC
CCAGTCGAGGATGAGGCCGAACCGGCTGTCAAGGAGCCCGCGGGCAGTGCGTCACTCCCTGCCCGCTTCCAGCTG
CGGTCCATCGTCTGCCACAAGGGGACTAGCATCCATGCTGGGTAAGTCTCCCGCTGTCGGCGCCAACCATCGTAC
GCTGACTGACTTGTTCCAGGCACTACGTGGCATTCATCCGGAAGCAACTCGAGGGGCAGGACAAGGCCCAGTGGG
TGCTCTTCAACGACGAAAAGGTTGTCGAGGCGCACGACGTCGACGAGATGCGCAAGTTTGCGTACGTGTATTTCT
TCCAACGTGCATGATTTTCGTCTTTTAGCAGGGGAATCTGTTCGAGAGCTTGGCTTTTGCCGACTTTAGTTGCTG
GAGGGGCTGGATCGGGACCGGGTTCATGGATGCAGGAAGCATAGAGGTACATCAAGACGGCGCGAGAGTAGCATA
GATCTTTCAAGACGATGCATACGAATCATCATTGAGCACTGAGACGGGCATTTCCGCAGTTACCAACCCGCGCAA
CGTCTATCCTCCGTCTCACTGAGCTCAGTCTCCGAGGCGGTAGCTGACGAGGGTGTCGACGCGGTGATTGGCGGT
GCTGAAGCCCCGCAGCTGGACGTGCTCTCCGTTGGCAATCTCCTTGGGGTCCGAGTCTCCCCACTCGACGGGGAC
GTCGCTGTCGGCGTCGGCGTAGACAAGGACGTTGAAGGTGCAGTTGCCGCTGAGCTGGGGGAGGAAGGTGACGGA
GGCGGTGATCTGGCGGAAGAGGGCGGCGATGTCGGCCTGAATATCGGCTTCGGACCGTTCGGGCTGGGATGCCGG
CGGCGCTGCGTTCTCCTCGTCCGCGGCGGTTGGCTTGGGCGCTGGCTTGGACGAGGTTTTGGGGGGTGGTTGCGA
GATTTGTACCTGCAGTGTTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail