Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4425
Gene name
LocationContig_408:12062..14591
Strand+
Gene length (bp)2529
Transcript length (bp)2391
Coding sequence length (bp)2391
Protein length (aa) 797

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12862 ANAPC5 Anaphase-promoting complex subunit 5 7.9E-33 290 379

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4W7|APC5_SCHPO Anaphase-promoting complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apc5 PE=1 SV=3 4 514 4.0E-43
sp|Q08683|APC5_YEAST Anaphase-promoting complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APC5 PE=1 SV=1 279 642 4.0E-15
sp|A1L1K3|APC5_RAT Anaphase-promoting complex subunit 5 OS=Rattus norvegicus GN=Anapc5 PE=2 SV=1 290 378 1.0E-06
sp|Q8BTZ4|APC5_MOUSE Anaphase-promoting complex subunit 5 OS=Mus musculus GN=Anapc5 PE=1 SV=1 290 378 1.0E-06
sp|Q5RE52|APC5_PONAB Anaphase-promoting complex subunit 5 OS=Pongo abelii GN=ANAPC5 PE=2 SV=1 290 378 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4W7|APC5_SCHPO Anaphase-promoting complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apc5 PE=1 SV=3 4 514 4.0E-43
sp|Q08683|APC5_YEAST Anaphase-promoting complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APC5 PE=1 SV=1 279 642 4.0E-15
sp|A1L1K3|APC5_RAT Anaphase-promoting complex subunit 5 OS=Rattus norvegicus GN=Anapc5 PE=2 SV=1 290 378 1.0E-06
sp|Q8BTZ4|APC5_MOUSE Anaphase-promoting complex subunit 5 OS=Mus musculus GN=Anapc5 PE=1 SV=1 290 378 1.0E-06
sp|Q5RE52|APC5_PONAB Anaphase-promoting complex subunit 5 OS=Pongo abelii GN=ANAPC5 PE=2 SV=1 290 378 1.0E-06
sp|Q9UJX4|APC5_HUMAN Anaphase-promoting complex subunit 5 OS=Homo sapiens GN=ANAPC5 PE=1 SV=2 290 378 1.0E-06
sp|Q5ZKK3|APC5_CHICK Anaphase-promoting complex subunit 5 OS=Gallus gallus GN=ANAPC5 PE=2 SV=1 268 373 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1947
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7281
Ophiocordyceps australis map64 (Brazil) OphauB2|5071
Ophiocordyceps camponoti-floridani Ophcf2|06139
Ophiocordyceps camponoti-rufipedis Ophun1|4425 (this protein)
Ophiocordyceps kimflemingae Ophio5|3765
Ophiocordyceps subramaniannii Hirsu2|2090

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4425
MARYLTPAKIGLLALIELYTEESVPSEAVLPVLTFITSHILHDSSALGSREARWSKAERTVSLVISIGDFEKLLS
GFPVVTGMPGRKLWDLFLAKLWDVDSLDAMHAFFETVPAMLAKAKGEGRSGEEDEDEEDEEKEDEDQPSTKKIKL
ARNSPFGAFVRRCRLEFQRLAFHVCTELWKDFVRYRQTTAAYLRRKNPSLGRLGFDKVLLLGGQDDWDPDGIAAL
AAVAYGDMLDGDESGTVAVSTDDIEGLVEFQIGRMQKYGNRVPVEIRLQFEDLLRDSSLVPSVRHYLSFLDAWRA
GDYTTAFDDLHRYFDYTMQYRDRLFYQYALMNLAVLQADFGCYRDAVSAMLETVSTARENRDMTCLNFALNWLFH
FGRAHPKLVHDLESHSMLGAGKESLAFLRVKAKESGMWTLWSSVLLAESKMALVNGDSVATSVEHMVRSSQVIVD
KRLKNMFGSQLSLQAALWNRLGLGRLSACASETFLRCHARNSVFEDELKHTCRLAFALAQRGKYDEALRRLDALD
DDDSLRWSWKPSQYWLKYRAVIKLKRDLHHGNLDAARRLLDQLLQSKADDLEPDMAFTVDSLHVDYLSRRGDIRA
ALAEVDSLMSRQRSEGRDVAEAVKLLLARVSLLDRCGRPLRALSAAVRATDMAWRARLLPCLWEAVGALSSMLVS
LAEFAAAVNLLTAVIPRSLECEADAPTARLYSILADAHMGLAGAAEARSSRRTELLTRALRAVQKALDHYSAVED
VERQCEAMAKKAMIMKLTGEAALAADYAAAYVELRKRAEALSLDGA*
Coding >Ophun1|4425
ATGGCCCGTTACCTGACACCAGCCAAGATCGGCCTGCTAGCCCTCATCGAGCTCTACACCGAAGAGTCGGTCCCG
AGCGAGGCGGTGCTCCCGGTGCTGACCTTTATCACGTCACACATTCTCCACGACAGCAGCGCCTTGGGCTCGCGA
GAGGCGCGATGGAGCAAGGCGGAGCGCACAGTCAGCCTCGTTATATCCATCGGCGACTTTGAAAAGCTTCTCAGT
GGCTTTCCCGTCGTGACGGGCATGCCTGGCAGGAAGCTGTGGGATCTTTTCCTCGCCAAGCTGTGGGATGTCGAC
TCTCTCGATGCGATGCACGCCTTCTTCGAAACTGTGCCTGCTATGCTAGCCAAGGCAAAAGGCGAGGGACGAAGC
GGTGAAGAAGACGAAGATGAGGAGGACGAGGAGAAAGAGGACGAAGATCAGCCGAGCACCAAGAAAATCAAGCTG
GCTCGAAACTCGCCGTTTGGCGCCTTTGTGCGCAGATGCCGACTCGAGTTCCAGCGGCTAGCCTTTCACGTCTGC
ACAGAGCTGTGGAAGGACTTTGTGCGCTATCGCCAGACTACAGCCGCCTACCTGCGGCGCAAGAACCCATCGCTC
GGCCGTTTGGGCTTCGACAAGGTGCTGCTGCTCGGCGGCCAGGATGACTGGGATCCAGACGGAATAGCGGCTCTG
GCTGCTGTTGCGTACGGGGATATGCTGGACGGTGATGAGAGCGGCACCGTGGCTGTGAGCACCGATGACATCGAG
GGTCTCGTCGAGTTCCAGATCGGACGTATGCAGAAGTACGGGAACAGAGTGCCTGTCGAGATACGGCTCCAGTTT
GAGGATTTGCTTCGCGATAGCTCCCTCGTGCCCAGCGTAAGGCACTATCTCAGCTTCCTCGATGCCTGGAGAGCA
GGCGACTACACAACGGCCTTTGACGATCTCCATCGATACTTTGACTACACCATGCAGTACCGCGACCGGCTCTTC
TACCAGTACGCCCTCATGAACCTGGCCGTCCTCCAAGCCGACTTTGGCTGCTACCGCGATGCTGTTTCGGCCATG
CTAGAGACGGTTTCGACGGCCCGCGAGAACCGCGACATGACGTGCCTCAACTTTGCCCTCAACTGGCTCTTCCAC
TTCGGGCGCGCCCACCCCAAGCTCGTGCACGACCTCGAGTCCCACAGCATGCTGGGAGCAGGAAAAGAGAGCCTG
GCGTTTCTACGAGTCAAGGCCAAGGAGTCGGGCATGTGGACGCTCTGGAGCTCGGTGCTACTGGCCGAGTCCAAG
ATGGCGCTCGTCAACGGCGACTCGGTGGCAACTTCAGTCGAACACATGGTGCGCAGCTCGCAGGTCATAGTCGAC
AAGCGGCTCAAGAACATGTTTGGCTCGCAGCTCTCGCTTCAGGCGGCGCTCTGGAATCGGCTCGGGCTCGGACGG
CTGTCAGCCTGCGCGTCAGAGACGTTTCTACGCTGCCATGCTCGCAACTCGGTCTTTGAGGACGAGCTGAAGCAC
ACGTGCCGGCTGGCGTTTGCGCTGGCTCAGCGTGGGAAGTACGACGAAGCACTGCGCAGGCTCGATGCCCTCGAT
GATGACGACTCGCTCCGCTGGTCTTGGAAGCCGAGCCAGTATTGGCTCAAGTACCGAGCCGTCATCAAGCTGAAG
CGCGACTTGCACCACGGCAACTTGGACGCGGCCCGCCGACTGCTGGATCAGCTGCTACAGTCCAAGGCAGACGAT
CTGGAACCGGACATGGCCTTTACCGTCGACTCGCTACACGTCGACTATCTCTCACGGCGAGGCGACATCAGGGCC
GCGCTGGCCGAGGTGGACTCTCTGATGAGCCGTCAACGGAGCGAAGGCCGGGACGTGGCCGAGGCCGTCAAGCTG
CTCCTAGCCCGCGTCTCGCTACTGGATCGCTGTGGAAGGCCGCTGCGAGCGCTATCGGCGGCGGTGAGGGCAACA
GACATGGCCTGGCGCGCGCGTCTCCTCCCATGCCTGTGGGAGGCAGTGGGCGCGCTATCATCCATGCTGGTGTCT
CTAGCCGAGTTCGCCGCAGCCGTCAATCTCCTAACAGCAGTGATCCCACGCTCCCTCGAGTGCGAAGCCGACGCG
CCGACCGCCCGCCTGTACTCCATCCTGGCAGACGCGCACATGGGTCTCGCGGGCGCGGCAGAGGCACGCTCCAGT
CGGCGGACGGAGCTGCTGACGCGGGCGCTTCGGGCGGTGCAGAAGGCGCTGGATCATTACTCGGCTGTCGAGGAC
GTGGAGCGCCAGTGCGAGGCCATGGCTAAGAAGGCTATGATTATGAAGCTTACGGGCGAGGCGGCGCTGGCGGCT
GACTATGCCGCTGCCTACGTGGAGTTGCGGAAGAGGGCCGAGGCGCTGAGCCTGGATGGGGCGTGA
Transcript >Ophun1|4425
ATGGCCCGTTACCTGACACCAGCCAAGATCGGCCTGCTAGCCCTCATCGAGCTCTACACCGAAGAGTCGGTCCCG
AGCGAGGCGGTGCTCCCGGTGCTGACCTTTATCACGTCACACATTCTCCACGACAGCAGCGCCTTGGGCTCGCGA
GAGGCGCGATGGAGCAAGGCGGAGCGCACAGTCAGCCTCGTTATATCCATCGGCGACTTTGAAAAGCTTCTCAGT
GGCTTTCCCGTCGTGACGGGCATGCCTGGCAGGAAGCTGTGGGATCTTTTCCTCGCCAAGCTGTGGGATGTCGAC
TCTCTCGATGCGATGCACGCCTTCTTCGAAACTGTGCCTGCTATGCTAGCCAAGGCAAAAGGCGAGGGACGAAGC
GGTGAAGAAGACGAAGATGAGGAGGACGAGGAGAAAGAGGACGAAGATCAGCCGAGCACCAAGAAAATCAAGCTG
GCTCGAAACTCGCCGTTTGGCGCCTTTGTGCGCAGATGCCGACTCGAGTTCCAGCGGCTAGCCTTTCACGTCTGC
ACAGAGCTGTGGAAGGACTTTGTGCGCTATCGCCAGACTACAGCCGCCTACCTGCGGCGCAAGAACCCATCGCTC
GGCCGTTTGGGCTTCGACAAGGTGCTGCTGCTCGGCGGCCAGGATGACTGGGATCCAGACGGAATAGCGGCTCTG
GCTGCTGTTGCGTACGGGGATATGCTGGACGGTGATGAGAGCGGCACCGTGGCTGTGAGCACCGATGACATCGAG
GGTCTCGTCGAGTTCCAGATCGGACGTATGCAGAAGTACGGGAACAGAGTGCCTGTCGAGATACGGCTCCAGTTT
GAGGATTTGCTTCGCGATAGCTCCCTCGTGCCCAGCGTAAGGCACTATCTCAGCTTCCTCGATGCCTGGAGAGCA
GGCGACTACACAACGGCCTTTGACGATCTCCATCGATACTTTGACTACACCATGCAGTACCGCGACCGGCTCTTC
TACCAGTACGCCCTCATGAACCTGGCCGTCCTCCAAGCCGACTTTGGCTGCTACCGCGATGCTGTTTCGGCCATG
CTAGAGACGGTTTCGACGGCCCGCGAGAACCGCGACATGACGTGCCTCAACTTTGCCCTCAACTGGCTCTTCCAC
TTCGGGCGCGCCCACCCCAAGCTCGTGCACGACCTCGAGTCCCACAGCATGCTGGGAGCAGGAAAAGAGAGCCTG
GCGTTTCTACGAGTCAAGGCCAAGGAGTCGGGCATGTGGACGCTCTGGAGCTCGGTGCTACTGGCCGAGTCCAAG
ATGGCGCTCGTCAACGGCGACTCGGTGGCAACTTCAGTCGAACACATGGTGCGCAGCTCGCAGGTCATAGTCGAC
AAGCGGCTCAAGAACATGTTTGGCTCGCAGCTCTCGCTTCAGGCGGCGCTCTGGAATCGGCTCGGGCTCGGACGG
CTGTCAGCCTGCGCGTCAGAGACGTTTCTACGCTGCCATGCTCGCAACTCGGTCTTTGAGGACGAGCTGAAGCAC
ACGTGCCGGCTGGCGTTTGCGCTGGCTCAGCGTGGGAAGTACGACGAAGCACTGCGCAGGCTCGATGCCCTCGAT
GATGACGACTCGCTCCGCTGGTCTTGGAAGCCGAGCCAGTATTGGCTCAAGTACCGAGCCGTCATCAAGCTGAAG
CGCGACTTGCACCACGGCAACTTGGACGCGGCCCGCCGACTGCTGGATCAGCTGCTACAGTCCAAGGCAGACGAT
CTGGAACCGGACATGGCCTTTACCGTCGACTCGCTACACGTCGACTATCTCTCACGGCGAGGCGACATCAGGGCC
GCGCTGGCCGAGGTGGACTCTCTGATGAGCCGTCAACGGAGCGAAGGCCGGGACGTGGCCGAGGCCGTCAAGCTG
CTCCTAGCCCGCGTCTCGCTACTGGATCGCTGTGGAAGGCCGCTGCGAGCGCTATCGGCGGCGGTGAGGGCAACA
GACATGGCCTGGCGCGCGCGTCTCCTCCCATGCCTGTGGGAGGCAGTGGGCGCGCTATCATCCATGCTGGTGTCT
CTAGCCGAGTTCGCCGCAGCCGTCAATCTCCTAACAGCAGTGATCCCACGCTCCCTCGAGTGCGAAGCCGACGCG
CCGACCGCCCGCCTGTACTCCATCCTGGCAGACGCGCACATGGGTCTCGCGGGCGCGGCAGAGGCACGCTCCAGT
CGGCGGACGGAGCTGCTGACGCGGGCGCTTCGGGCGGTGCAGAAGGCGCTGGATCATTACTCGGCTGTCGAGGAC
GTGGAGCGCCAGTGCGAGGCCATGGCTAAGAAGGCTATGATTATGAAGCTTACGGGCGAGGCGGCGCTGGCGGCT
GACTATGCCGCTGCCTACGTGGAGTTGCGGAAGAGGGCCGAGGCGCTGAGCCTGGATGGGGCGTGA
Gene >Ophun1|4425
ATGGCCCGTTACCTGACACCAGCCAAGATCGGCCTGCTAGCCCTCATCGAGCTCTACACCGAAGAGTCGGTCCCG
AGCGAGGCGGTGCTCCCGGTGCTGACCTTTATCACGTCACACATTCTCCACGACAGCAGCGCCTTGGGCTCGCGA
GAGGCGCGATGGAGCAAGGCGGAGCGCACAGTCAGCCTCGTTATATCCATCGGCGACTTTGAAAAGCTTCTCAGT
GGCTTTCCCGTCGTGACGGGCATGCCTGGCAGGAAGCTGTGGGATCTTTTCCTCGCCAAGCTGTGGGATGTCGAC
TCTCTCGATGCGATGCACGCCTTCTTCGAAACTGTGCCTGCTATGCTAGCCAAGGCAAAAGGCGAGGGACGAAGC
GGTGAAGAAGACGAAGATGAGGAGGACGAGGAGAAAGAGGACGAAGATCAGCCGAGCACCAAGAAAATCAAGCTG
GCTCGAAACTCGCCGTTTGGCGCCTTTGTGCGCAGATGCCGACTCGAGTTCCAGCGGCTAGCCTTTCACGTCTGC
ACAGAGCTGTGGAAGGACTTTGTGCGCTATCGCCAGACTACAGCCGCCTACCTGCGGCGCAAGAACCCATCGCTC
GGCCGTTTGGGCTTCGACAAGGTGCTGCTGCTCGGCGGCCAGGATGACTGGGATCCAGACGGAATAGCGGCTCTG
GCTGCTGTTGCGTACGGGGATATGCTGGACGGTGATGAGAGCGGCACCGTGGCTGTGAGCACCGATGACATCGAG
GGTCTCGTCGAGTTCCAGATCGGACGTATGCAGAGTAAGTGTTCGCCTTGGGTTGTAGCTCGCTGTTGCTGACTG
AAGCAACTGAAAGAGTACGGGAACAGAGTGCCTGTCGAGATACGGCTCCAGTTTGAGGATTTGCTTCGCGATAGC
TCCCTCGTGCCCAGCGTAAGGCACTATCTCAGGTTCGTCTTCTTCCGACAGCTTTGTTCCTTTCCTTTGTTACCC
ATACTCGTGTTTCGCCTGCTGACTTGCGACGATTCTGGTAGCTTCCTCGATGCCTGGAGAGCAGGCGACTACACA
ACGGCCTTTGACGATCTCCATCGATACTTTGACTACACCATGCAGTACCGCGACCGGCTCTTCTACCAGTACGCC
CTCATGAACCTGGCCGTCCTCCAAGCCGACTTTGGCTGCTACCGCGATGCTGTTTCGGCCATGCTAGAGACGGTT
TCGACGGCCCGCGAGAACCGCGACATGACGTGCCTCAACTTTGCCCTCAACTGGCTCTTCCACTTCGGGCGCGCC
CACCCCAAGCTCGTGCACGACCTCGAGTCCCACAGCATGCTGGGAGCAGGAAAAGAGAGCCTGGCGTTTCTACGA
GTCAAGGCCAAGGAGTCGGGCATGTGGACGCTCTGGAGCTCGGTGCTACTGGCCGAGTCCAAGATGGCGCTCGTC
AACGGCGACTCGGTGGCAACTTCAGTCGAACACATGGTGCGCAGCTCGCAGGTCATAGTCGACAAGCGGCTCAAG
AACATGTTTGGCTCGCAGCTCTCGCTTCAGGCGGCGCTCTGGAATCGGCTCGGGCTCGGACGGCTGTCAGCCTGC
GCGTCAGAGACGTTTCTACGCTGCCATGCTCGCAACTCGGTCTTTGAGGACGAGCTGAAGCACACGTGCCGGCTG
GCGTTTGCGCTGGCTCAGCGTGGGAAGTACGACGAAGCACTGCGCAGGCTCGATGCCCTCGATGATGACGACTCG
CTCCGCTGGTCTTGGAAGCCGAGCCAGTATTGGCTCAAGTACCGAGCCGTCATCAAGCTGAAGCGCGACTTGCAC
CACGGCAACTTGGACGCGGCCCGCCGACTGCTGGATCAGCTGCTACAGTCCAAGGCAGACGATCTGGAACCGGAC
ATGGCCTTTACCGTCGACTCGCTACACGTCGACTATCTCTCACGGCGAGGCGACATCAGGGCCGCGCTGGCCGAG
GTGGACTCTCTGATGAGCCGTCAACGGAGCGAAGGCCGGGACGTGGCCGAGGCCGTCAAGCTGCTCCTAGCCCGC
GTCTCGCTACTGGATCGCTGTGGAAGGCCGCTGCGAGCGCTATCGGCGGCGGTGAGGGCAACAGACATGGCCTGG
CGCGCGCGTCTCCTCCCATGCCTGTGGGAGGCAGTGGGCGCGCTATCATCCATGCTGGTGTCTCTAGCCGAGTTC
GCCGCAGCCGTCAATCTCCTAACAGCAGTGATCCCACGCTCCCTCGAGTGCGAAGCCGACGCGCCGACCGCCCGC
CTGTACTCCATCCTGGCAGACGCGCACATGGGTCTCGCGGGCGCGGCAGAGGCACGCTCCAGTCGGCGGACGGAG
CTGCTGACGCGGGCGCTTCGGGCGGTGCAGAAGGCGCTGGATCATTACTCGGCTGTCGAGGACGTGGAGCGCCAG
TGCGAGGCCATGGCTAAGAAGGCTATGATTATGAAGCTTACGGGCGAGGCGGCGCTGGCGGCTGACTATGCCGCT
GCCTACGTGGAGTTGCGGAAGAGGGCCGAGGCGCTGAGCCTGGATGGGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail