Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4423
Gene name
LocationContig_408:9235..10666
Strand-
Gene length (bp)1431
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11708 Slu7 Pre-mRNA splicing Prp18-interacting factor 5.7E-71 118 357

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q51LA6|SLU7_MAGO7 Pre-mRNA-splicing factor SLU7 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SLU7 PE=3 SV=1 13 476 0.0E+00
sp|Q5B3U2|SLU7_EMENI Pre-mRNA-splicing factor slu7 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=slu7 PE=3 SV=1 15 473 7.0E-180
sp|Q4WWR2|SLU7_ASPFU Pre-mRNA-splicing factor slu7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=slu7 PE=3 SV=2 15 472 5.0E-175
sp|Q7SDY6|SLU7_NEUCR Pre-mRNA-splicing factor slu-7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=slu-7 PE=3 SV=1 4 391 4.0E-152
sp|Q3KQD1|SLU7_XENLA Pre-mRNA-splicing factor SLU7 OS=Xenopus laevis GN=slu7 PE=2 SV=2 18 471 1.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q51LA6|SLU7_MAGO7 Pre-mRNA-splicing factor SLU7 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SLU7 PE=3 SV=1 13 476 0.0E+00
sp|Q5B3U2|SLU7_EMENI Pre-mRNA-splicing factor slu7 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=slu7 PE=3 SV=1 15 473 7.0E-180
sp|Q4WWR2|SLU7_ASPFU Pre-mRNA-splicing factor slu7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=slu7 PE=3 SV=2 15 472 5.0E-175
sp|Q7SDY6|SLU7_NEUCR Pre-mRNA-splicing factor slu-7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=slu-7 PE=3 SV=1 4 391 4.0E-152
sp|Q3KQD1|SLU7_XENLA Pre-mRNA-splicing factor SLU7 OS=Xenopus laevis GN=slu7 PE=2 SV=2 18 471 1.0E-90
sp|Q5ZIG2|SLU7_CHICK Pre-mRNA-splicing factor SLU7 OS=Gallus gallus GN=SLU7 PE=2 SV=1 18 471 5.0E-89
sp|Q8BHJ9|SLU7_MOUSE Pre-mRNA-splicing factor SLU7 OS=Mus musculus GN=Slu7 PE=1 SV=1 18 471 9.0E-89
sp|P0CR52|SLU7_CRYNJ Pre-mRNA-splicing factor SLU7 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SLU7 PE=3 SV=1 21 384 3.0E-88
sp|P0CR53|SLU7_CRYNB Pre-mRNA-splicing factor SLU7 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SLU7 PE=3 SV=1 21 384 3.0E-88
sp|Q80ZG5|SLU7_RAT Pre-mRNA-splicing factor SLU7 OS=Rattus norvegicus GN=Slu7 PE=1 SV=2 18 471 4.0E-88
sp|Q54TA0|SLU7_DICDI Pre-mRNA-splicing factor slu7 OS=Dictyostelium discoideum GN=slu7 PE=2 SV=1 18 384 4.0E-87
sp|Q3ZBE5|SLU7_BOVIN Pre-mRNA-splicing factor SLU7 OS=Bos taurus GN=SLU7 PE=2 SV=2 18 471 2.0E-86
sp|Q4R4P2|SLU7_MACFA Pre-mRNA-splicing factor SLU7 OS=Macaca fascicularis GN=SLU7 PE=2 SV=1 18 471 4.0E-86
sp|O95391|SLU7_HUMAN Pre-mRNA-splicing factor SLU7 OS=Homo sapiens GN=SLU7 PE=1 SV=2 18 471 8.0E-86
sp|Q6ZK48|SLU7_ORYSJ Pre-mRNA-splicing factor SLU7 OS=Oryza sativa subsp. japonica GN=Os08g0127700 PE=2 SV=1 18 469 6.0E-84
sp|A2YQU8|SLU7_ORYSI Pre-mRNA-splicing factor SLU7 OS=Oryza sativa subsp. indica GN=OsI_27673 PE=3 SV=2 18 469 6.0E-84
sp|Q9SHY8|SLU7A_ARATH Pre-mRNA-splicing factor SLU7-A OS=Arabidopsis thaliana GN=At1g65660 PE=1 SV=2 18 469 3.0E-83
sp|Q5U3F2|SLU7_DANRE Pre-mRNA-splicing factor SLU7 OS=Danio rerio GN=slu7 PE=2 SV=1 18 386 7.0E-83
sp|O23174|SLU7B_ARATH Pre-mRNA-splicing factor SLU7-B OS=Arabidopsis thaliana GN=At4g37120 PE=2 SV=3 18 470 3.0E-82
sp|Q21278|SLU7_CAEEL Pre-mRNA-splicing factor SLU7 OS=Caenorhabditis elegans GN=K07C5.6 PE=3 SV=1 21 402 1.0E-78
sp|Q9VAQ7|SLU7_DROME Pre-mRNA-splicing factor Slu7 OS=Drosophila melanogaster GN=Slu7 PE=1 SV=2 21 387 5.0E-78
sp|Q6C9T0|SLU7_YARLI Pre-mRNA-splicing factor SLU7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SLU7 PE=3 SV=1 10 381 1.0E-66
sp|Q9Y7Y2|SLU7_SCHPO Pre-mRNA-splicing factor slu7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slu7 PE=1 SV=1 20 296 5.0E-66
sp|Q6BMK7|SLU7_DEBHA Pre-mRNA-splicing factor SLU7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SLU7 PE=3 SV=2 9 379 2.0E-24
sp|Q02775|SLU7_YEAST Pre-mRNA-splicing factor SLU7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLU7 PE=1 SV=1 15 283 2.0E-13
sp|Q74ZN9|SLU7_ASHGO Pre-mRNA-splicing factor SLU7 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SLU7 PE=3 SV=1 19 210 2.0E-11
sp|Q5ADL4|SLU7_CANAL Pre-mRNA-splicing factor SLU7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLU7 PE=3 SV=1 119 380 7.0E-11
sp|Q6FRY5|SLU7_CANGA Pre-mRNA-splicing factor SLU7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SLU7 PE=3 SV=1 12 283 1.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1954
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5283
Ophiocordyceps australis map64 (Brazil) OphauB2|5047
Ophiocordyceps camponoti-floridani Ophcf2|06131
Ophiocordyceps camponoti-rufipedis Ophun1|4423 (this protein)
Ophiocordyceps kimflemingae Ophio5|5020
Ophiocordyceps subramaniannii Hirsu2|2102

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4423
MPAPPPPPRKTQSGAASKEENIYIPSFISKRPFYAVDDSEDADYLKHQRREEKKEQSQWYDRGKRAGPAATKYRK
GACENCGAITHKAKDCLSRPRAKGAKWTGKDIQADEKIQDIQLGWDAKRDRWNGYDTREYRHVVQEFNQMEDLRK
EAKRAMNVEDAEDEGDKYAEENDMSKHQSTATRQLRIREDTAKYLLNLDLESAKYDPKTRSLVNAGATGGKSADL
FAEEGFLKSTGEAADFERAQRYAWEAQERAGDTTQHLQANPTAGAFSRKKEIEEEERQRAERDELLRERYGGSAD
DDNKQKPIALLNMKITESETFVEYDESGLIKGAPRQAAKSKYAEDVLVNNHGSVWGSWWSNFKWGYACCHSLIKN
SYCTGEQGKEAWEAAERQRTGADVVLFDNGDDGQRDDQAGEEEGEARKRDVVVAGKEKARARTREEMFNGVTEAE
MDEYRRKKTVADDPMAKLLGKDELLS*
Coding >Ophun1|4423
ATGCCTGCGCCGCCTCCGCCCCCGCGAAAGACCCAGTCGGGCGCGGCCTCCAAGGAAGAGAACATCTACATCCCC
TCCTTCATCAGCAAGCGGCCCTTCTATGCCGTCGATGACAGCGAAGACGCCGACTACCTCAAGCATCAGCGGCGC
GAGGAGAAGAAAGAGCAGTCACAGTGGTACGACCGCGGCAAGCGAGCCGGTCCGGCAGCCACCAAATACCGGAAA
GGCGCCTGCGAAAACTGCGGCGCCATCACACACAAGGCAAAAGACTGCCTGAGCCGTCCGAGAGCCAAGGGCGCA
AAGTGGACGGGCAAGGACATACAAGCGGACGAAAAGATTCAGGATATCCAGCTTGGCTGGGATGCTAAGCGCGAT
CGGTGGAATGGCTACGATACGCGCGAGTACCGGCACGTCGTGCAAGAGTTCAACCAGATGGAAGACCTACGCAAG
GAGGCAAAACGGGCCATGAACGTCGAGGACGCAGAAGACGAGGGCGACAAGTACGCAGAGGAGAACGACATGAGC
AAGCATCAGAGCACGGCAACGCGCCAGCTGCGAATCCGCGAGGACACGGCCAAATACCTGTTGAACCTCGATCTC
GAGTCGGCAAAGTACGACCCCAAGACGCGATCTCTCGTCAACGCCGGCGCAACCGGCGGCAAGTCGGCAGACTTA
TTCGCCGAGGAGGGCTTCCTCAAGTCGACGGGCGAAGCAGCCGACTTCGAAAGAGCCCAGCGCTACGCCTGGGAG
GCGCAGGAGAGGGCCGGCGACACAACGCAGCATCTGCAGGCCAATCCCACCGCCGGCGCCTTCTCCCGAAAGAAG
GAGATTGAAGAGGAGGAGAGGCAACGGGCTGAGCGCGACGAGCTCTTACGAGAGAGATACGGAGGAAGCGCAGAC
GACGACAATAAACAAAAGCCCATAGCGCTGCTGAACATGAAGATTACAGAGTCGGAGACATTCGTCGAGTACGAC
GAGAGCGGCCTCATCAAAGGCGCGCCCCGTCAAGCGGCAAAGTCAAAGTACGCCGAGGACGTGCTCGTCAACAAC
CACGGCTCCGTCTGGGGAAGCTGGTGGTCCAACTTCAAATGGGGCTACGCCTGCTGCCACTCGCTCATCAAGAAC
AGCTACTGCACCGGCGAGCAGGGCAAGGAGGCCTGGGAGGCAGCCGAGCGGCAGCGGACAGGCGCCGACGTCGTC
CTCTTTGATAATGGTGATGACGGTCAGCGGGACGACCAGGCGGGCGAGGAGGAGGGGGAGGCGCGGAAGAGGGAC
GTTGTGGTTGCGGGCAAGGAGAAGGCTCGGGCGCGAACTCGAGAAGAGATGTTTAATGGTGTCACTGAGGCGGAG
ATGGATGAGTATAGGCGGAAGAAGACGGTGGCGGACGATCCCATGGCGAAGCTATTGGGGAAAGACGAGTTGTTA
AGTTGA
Transcript >Ophun1|4423
ATGCCTGCGCCGCCTCCGCCCCCGCGAAAGACCCAGTCGGGCGCGGCCTCCAAGGAAGAGAACATCTACATCCCC
TCCTTCATCAGCAAGCGGCCCTTCTATGCCGTCGATGACAGCGAAGACGCCGACTACCTCAAGCATCAGCGGCGC
GAGGAGAAGAAAGAGCAGTCACAGTGGTACGACCGCGGCAAGCGAGCCGGTCCGGCAGCCACCAAATACCGGAAA
GGCGCCTGCGAAAACTGCGGCGCCATCACACACAAGGCAAAAGACTGCCTGAGCCGTCCGAGAGCCAAGGGCGCA
AAGTGGACGGGCAAGGACATACAAGCGGACGAAAAGATTCAGGATATCCAGCTTGGCTGGGATGCTAAGCGCGAT
CGGTGGAATGGCTACGATACGCGCGAGTACCGGCACGTCGTGCAAGAGTTCAACCAGATGGAAGACCTACGCAAG
GAGGCAAAACGGGCCATGAACGTCGAGGACGCAGAAGACGAGGGCGACAAGTACGCAGAGGAGAACGACATGAGC
AAGCATCAGAGCACGGCAACGCGCCAGCTGCGAATCCGCGAGGACACGGCCAAATACCTGTTGAACCTCGATCTC
GAGTCGGCAAAGTACGACCCCAAGACGCGATCTCTCGTCAACGCCGGCGCAACCGGCGGCAAGTCGGCAGACTTA
TTCGCCGAGGAGGGCTTCCTCAAGTCGACGGGCGAAGCAGCCGACTTCGAAAGAGCCCAGCGCTACGCCTGGGAG
GCGCAGGAGAGGGCCGGCGACACAACGCAGCATCTGCAGGCCAATCCCACCGCCGGCGCCTTCTCCCGAAAGAAG
GAGATTGAAGAGGAGGAGAGGCAACGGGCTGAGCGCGACGAGCTCTTACGAGAGAGATACGGAGGAAGCGCAGAC
GACGACAATAAACAAAAGCCCATAGCGCTGCTGAACATGAAGATTACAGAGTCGGAGACATTCGTCGAGTACGAC
GAGAGCGGCCTCATCAAAGGCGCGCCCCGTCAAGCGGCAAAGTCAAAGTACGCCGAGGACGTGCTCGTCAACAAC
CACGGCTCCGTCTGGGGAAGCTGGTGGTCCAACTTCAAATGGGGCTACGCCTGCTGCCACTCGCTCATCAAGAAC
AGCTACTGCACCGGCGAGCAGGGCAAGGAGGCCTGGGAGGCAGCCGAGCGGCAGCGGACAGGCGCCGACGTCGTC
CTCTTTGATAATGGTGATGACGGTCAGCGGGACGACCAGGCGGGCGAGGAGGAGGGGGAGGCGCGGAAGAGGGAC
GTTGTGGTTGCGGGCAAGGAGAAGGCTCGGGCGCGAACTCGAGAAGAGATGTTTAATGGTGTCACTGAGGCGGAG
ATGGATGAGTATAGGCGGAAGAAGACGGTGGCGGACGATCCCATGGCGAAGCTATTGGGGAAAGACGAGTTGTTA
AGTTGA
Gene >Ophun1|4423
ATGCCTGCGCCGCCTCCGCCCCCGCGAAAGACCCAGTCGGGCGCGGCCTCCAAGGAAGAGAACATCTACATCCCC
TCCTTCATCAGCAAGCGGCCCTTCTATGCCGTCGATGACAGCGAAGACGCCGACTACCTCAAGCATCAGCGGCGC
GAGGAGAAGAAAGAGCAGTCACAGTGGTACGACCGCGGCAAGCGAGCCGGTCCGGCAGCCACCAAATACCGGAAA
GGCGCCTGCGAAAACTGCGGCGCCATCACACACAAGGCAAAAGACTGCCTGAGCCGTCCGAGAGCCAAGGGCGCA
AAGTGGACGGGCAAGGACATACAAGCGGACGAAAAGATTCAGGATATCCAGCTTGGCTGGGATGCTAAGCGCGAT
CGGTGGAATGGCTACGATACGCGCGAGTACCGGCACGTCGTGCAAGAGTTCAACCAGATGGAAGACCTACGCAAG
GAGGCAAAACGGGCCATGAACGTCGAGGACGCAGAAGACGAGGGCGACAAGTACGCAGAGGAGAACGACATGAGC
AAGCATCAGAGCACGGCAACGCGCCAGCTGCGAATCCGCGAGGACACGGCCAAATACCTGTTGAACCTCGATCTC
GAGTCGGCAAAGTACGACCCCAAGACGCGATCTCTCGTCAACGCCGGCGCAACCGGCGGCAAGTCGGCAGACTTA
TTCGCCGAGGAGGGCTTCCTCAAGTCGACGGGCGAAGCAGCCGACTTCGAAAGAGCCCAGCGCTACGCCTGGGAG
GCGCAGGAGAGGGCCGGCGACACAACGCAGCATCTGCAGGCCAATCCCACCGCCGGCGCCTTCTCCCGAAAGAAG
GAGATTGAAGAGGAGGAGAGGCAACGGGCTGAGCGCGACGAGCTCTTACGAGAGAGATACGGAGGAAGCGCAGAC
GACGACAATAAACAAAAGCCCATAGCGCTGCTGAACATGAAGATTACAGAGTCGGAGACATTCGTCGAGTACGAC
GAGAGCGGCCTCATCAAAGGCGCGCCCCGTCAAGCGGCAAAGTCAAAGTACGCCGAGGACGTGCTCGTCAACAAC
CACGGCTCCGTCTGGGGAAGCTGGTGGTCCAACTTCAAATGGGGCTACGCCTGCTGCCACTCGCTCATCAAGAAC
AGCTACTGCACCGGCGAGCAGGGCAAGGAGGCCTGGGAGGCAGCCGAGCGGCAGCGGACAGGCGCCGACGTCGTC
CTCTTTGATAATGGTGATGACGGTCAGCGGGACGACCAGGCGGGCGAGGAGGAGGGGGAGGCGCGGAAGAGGGAC
GTTGTGGTTGCGGGCAAGGAGAAGGCTCGGGCGCGAACTCGAGAAGAGATGTTTAATGGTGTCACTGAGGCGGAG
ATGGATGAGTATAGGCGGAAGAAGACGGTGGCGGACGATCCCATGGCGAAGCTATTGGGGAAAGACGAGTTGTTA
AGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail