Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4422
Gene name
LocationContig_408:8193..8903
Strand+
Gene length (bp)710
Transcript length (bp)576
Coding sequence length (bp)576
Protein length (aa) 192

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01479 S4 S4 domain 2.6E-12 105 148
PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain 1.6E-10 7 104

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52810|RS9_PODAS 40S ribosomal protein S9 OS=Podospora anserina GN=RPS9 PE=3 SV=1 1 190 3.0E-110
sp|O59675|RS9B_SCHPO 40S ribosomal protein S9-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps902 PE=1 SV=3 1 179 1.0E-101
sp|Q09757|RS9A_SCHPO 40S ribosomal protein S9-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps901 PE=1 SV=2 1 177 3.0E-101
sp|P55935|RS9_DROME 40S ribosomal protein S9 OS=Drosophila melanogaster GN=RpS9 PE=1 SV=2 3 179 1.0E-99
sp|P29314|RS9_RAT 40S ribosomal protein S9 OS=Rattus norvegicus GN=Rps9 PE=1 SV=4 8 191 4.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52810|RS9_PODAS 40S ribosomal protein S9 OS=Podospora anserina GN=RPS9 PE=3 SV=1 1 190 3.0E-110
sp|O59675|RS9B_SCHPO 40S ribosomal protein S9-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps902 PE=1 SV=3 1 179 1.0E-101
sp|Q09757|RS9A_SCHPO 40S ribosomal protein S9-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps901 PE=1 SV=2 1 177 3.0E-101
sp|P55935|RS9_DROME 40S ribosomal protein S9 OS=Drosophila melanogaster GN=RpS9 PE=1 SV=2 3 179 1.0E-99
sp|P29314|RS9_RAT 40S ribosomal protein S9 OS=Rattus norvegicus GN=Rps9 PE=1 SV=4 8 191 4.0E-98
sp|A9L913|RS9_PAPAN 40S ribosomal protein S9 OS=Papio anubis GN=RPS9 PE=3 SV=1 8 191 4.0E-98
sp|Q6ZWN5|RS9_MOUSE 40S ribosomal protein S9 OS=Mus musculus GN=Rps9 PE=1 SV=3 8 191 4.0E-98
sp|P46781|RS9_HUMAN 40S ribosomal protein S9 OS=Homo sapiens GN=RPS9 PE=1 SV=3 8 191 4.0E-98
sp|A6QLG5|RS9_BOVIN 40S ribosomal protein S9 OS=Bos taurus GN=RPS9 PE=2 SV=1 8 191 4.0E-98
sp|Q20228|RS9_CAEEL 40S ribosomal protein S9 OS=Caenorhabditis elegans GN=rps-9 PE=3 SV=1 7 187 7.0E-95
sp|O13516|RS9A_YEAST 40S ribosomal protein S9-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS9A PE=1 SV=3 1 183 7.0E-94
sp|P05755|RS9B_YEAST 40S ribosomal protein S9-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS9B PE=1 SV=4 1 175 2.0E-93
sp|Q9LXG1|RS91_ARATH 40S ribosomal protein S9-1 OS=Arabidopsis thaliana GN=RPS9B PE=1 SV=1 4 182 2.0E-91
sp|Q9FLF0|RS92_ARATH 40S ribosomal protein S9-2 OS=Arabidopsis thaliana GN=RPS9C PE=1 SV=1 4 182 1.0E-88
sp|P14132|RS9_DICDI 40S ribosomal protein S9 OS=Dictyostelium discoideum GN=rps9 PE=1 SV=1 6 188 5.0E-84
sp|P17959|RS9_TRYBB Probable 40S ribosomal protein S9 OS=Trypanosoma brucei brucei PE=3 SV=1 6 189 1.0E-75
sp|Q25555|RS9_NAEFO 40S ribosomal protein S9 OS=Naegleria fowleri GN=RPS9 PE=2 SV=1 4 180 9.0E-72
sp|Q29197|RS9_PIG 40S ribosomal protein S9 (Fragment) OS=Sus scrofa GN=RPS9 PE=2 SV=1 8 129 8.0E-66
sp|O15612|RS9_ENTHI 40S ribosomal protein S9 OS=Entamoeba histolytica GN=2.t00127 PE=2 SV=2 4 179 9.0E-55
sp|A8A8W3|RS4_IGNH4 30S ribosomal protein S4 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps4 PE=3 SV=1 3 162 3.0E-35
sp|A0B9L2|RS4_METTP 30S ribosomal protein S4 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps4 PE=3 SV=1 3 162 4.0E-35
sp|Q8TVC0|RS4_METKA 30S ribosomal protein S4 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps4 PE=3 SV=1 3 162 5.0E-35
sp|A7IAH7|RS4_METB6 30S ribosomal protein S4 OS=Methanoregula boonei (strain 6A8) GN=rps4 PE=3 SV=1 3 162 3.0E-34
sp|Q8SRW6|RS9_ENCCU 40S ribosomal protein S9 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS9 PE=1 SV=1 1 185 4.0E-33
sp|A3DMQ4|RS4_STAMF 30S ribosomal protein S4 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps4 PE=3 SV=1 3 162 9.0E-33
sp|O28000|RS4_ARCFU 30S ribosomal protein S4 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps4 PE=3 SV=1 3 163 6.0E-32
sp|Q46GC8|RS4_METBF 30S ribosomal protein S4 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps4 PE=3 SV=1 3 164 8.0E-32
sp|Q6KZP7|RS4_PICTO 30S ribosomal protein S4 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps4 PE=3 SV=1 12 162 1.0E-31
sp|Q2FT97|RS4_METHJ 30S ribosomal protein S4 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps4 PE=3 SV=1 3 164 3.0E-31
sp|Q96YV8|RS4_SULTO 30S ribosomal protein S4 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps4 PE=3 SV=1 3 162 3.0E-30
sp|A2SSV9|RS4_METLZ 30S ribosomal protein S4 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps4 PE=3 SV=1 3 172 4.0E-30
sp|A1RWT8|RS4_THEPD 30S ribosomal protein S4 OS=Thermofilum pendens (strain Hrk 5) GN=rps4 PE=3 SV=1 3 168 5.0E-30
sp|A2BK77|RS4_HYPBU 30S ribosomal protein S4 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps4 PE=3 SV=1 3 166 8.0E-30
sp|P39467|RS4_SULAC 30S ribosomal protein S4 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps4 PE=3 SV=3 3 162 1.0E-29
sp|P54020|RS4_METJA 30S ribosomal protein S4 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps4 PE=3 SV=1 2 164 2.0E-29
sp|Q9YB58|RS4_AERPE 30S ribosomal protein S4 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps4 PE=3 SV=2 3 162 4.0E-29
sp|C3N8R6|RS4_SULIY 30S ribosomal protein S4 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rps4 PE=3 SV=1 3 164 5.0E-29
sp|C3NMQ2|RS4_SULIN 30S ribosomal protein S4 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rps4 PE=3 SV=1 3 164 5.0E-29
sp|C3MZ03|RS4_SULIM 30S ribosomal protein S4 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rps4 PE=3 SV=1 3 164 5.0E-29
sp|C3MJP5|RS4_SULIL 30S ribosomal protein S4 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rps4 PE=3 SV=1 3 164 5.0E-29
sp|C4KJ91|RS4_SULIK 30S ribosomal protein S4 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rps4 PE=3 SV=1 3 164 5.0E-29
sp|C3N052|RS4_SULIA 30S ribosomal protein S4 OS=Sulfolobus islandicus (strain M.16.27) GN=rps4 PE=3 SV=1 3 164 5.0E-29
sp|Q8TRR1|RS4_METAC 30S ribosomal protein S4 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps4 PE=3 SV=1 3 162 3.0E-28
sp|Q9HJD7|RS4_THEAC 30S ribosomal protein S4 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps4 PE=3 SV=1 3 188 3.0E-28
sp|B8GEG7|RS4_METPE 30S ribosomal protein S4 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rps4 PE=3 SV=1 3 164 4.0E-28
sp|P49214|RS9_TOBAC 40S ribosomal protein S9 (Fragment) OS=Nicotiana tabacum GN=RPS9 PE=2 SV=1 117 174 5.0E-28
sp|A5UN53|RS4_METS3 30S ribosomal protein S4 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps4 PE=3 SV=1 3 179 1.0E-27
sp|Q8PV18|RS4_METMA 30S ribosomal protein S4 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps4 PE=3 SV=1 3 164 1.0E-27
sp|O26142|RS4_METTH 30S ribosomal protein S4 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps4 PE=3 SV=1 3 162 2.0E-27
sp|Q0W1V5|RS4_METAR 30S ribosomal protein S4 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps4 PE=3 SV=1 3 162 5.0E-27
sp|A4FWL4|RS4_METM5 30S ribosomal protein S4 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps4 PE=3 SV=1 3 164 7.0E-27
sp|A6VGQ7|RS4_METM7 30S ribosomal protein S4 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps4 PE=3 SV=1 3 164 7.0E-27
sp|A6UW05|RS4_META3 30S ribosomal protein S4 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps4 PE=3 SV=1 3 164 1.0E-26
sp|Q97B95|RS4_THEVO 30S ribosomal protein S4 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps4 PE=3 SV=1 3 164 1.0E-26
sp|Q3IQT8|RS4_NATPD 30S ribosomal protein S4 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps4 PE=3 SV=1 7 162 3.0E-26
sp|P95987|RS4_SULSO 30S ribosomal protein S4 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps4 PE=3 SV=1 3 164 5.0E-26
sp|Q12ZR5|RS4_METBU 30S ribosomal protein S4 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps4 PE=3 SV=1 3 162 8.0E-26
sp|C6A1B1|RS4_THESM 30S ribosomal protein S4 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rps4 PE=3 SV=1 3 166 1.0E-25
sp|Q9HQJ6|RS4_HALSA 30S ribosomal protein S4 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps4 PE=3 SV=1 3 160 3.0E-25
sp|B0R4Y0|RS4_HALS3 30S ribosomal protein S4 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rps4 PE=3 SV=1 3 160 3.0E-25
sp|A9A9Z3|RS4_METM6 30S ribosomal protein S4 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps4 PE=3 SV=1 3 164 3.0E-25
sp|P61993|RS4_PYRFU 30S ribosomal protein S4 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps4 PE=1 SV=1 3 164 3.0E-25
sp|P61992|RS4_PYRAB 30S ribosomal protein S4 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps4 PE=3 SV=1 3 164 3.0E-25
sp|O59306|RS4_PYRHO 30S ribosomal protein S4 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps4 PE=3 SV=1 3 164 4.0E-25
sp|A6UPW5|RS4_METVS 30S ribosomal protein S4 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps4 PE=3 SV=1 3 163 5.0E-25
sp|B6YSQ1|RS4_THEON 30S ribosomal protein S4 OS=Thermococcus onnurineus (strain NA1) GN=rps4 PE=3 SV=1 3 181 1.0E-24
sp|Q6LXN0|RS4_METMP 30S ribosomal protein S4 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps4 PE=3 SV=1 3 164 2.0E-24
sp|C5A251|RS4_THEGJ 30S ribosomal protein S4 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rps4 PE=3 SV=1 3 163 3.0E-24
sp|A8MDS5|RS4_CALMQ 30S ribosomal protein S4 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rps4 PE=3 SV=1 13 160 5.0E-24
sp|Q5JJF2|RS4_THEKO 30S ribosomal protein S4 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps4 PE=3 SV=1 3 181 3.0E-23
sp|Q2NFZ4|RS4_METST 30S ribosomal protein S4 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps4 PE=3 SV=1 3 156 4.0E-23
sp|Q8ZTV1|RS4_PYRAE 30S ribosomal protein S4 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps4 PE=3 SV=1 13 146 8.0E-23
sp|Q00862|RS4_HALMA 30S ribosomal protein S4 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps4 PE=3 SV=1 7 162 1.0E-22
sp|Q74NF7|RS4_NANEQ 30S ribosomal protein S4 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps4 PE=3 SV=1 13 164 1.0E-22
sp|B1L795|RS4_KORCO 30S ribosomal protein S4 OS=Korarchaeum cryptofilum (strain OPF8) GN=rps4 PE=3 SV=1 4 155 2.0E-22
sp|Q18G54|RS4_HALWD 30S ribosomal protein S4 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps4 PE=3 SV=1 1 162 3.0E-22
sp|B1Y9B8|RS4_PYRNV 30S ribosomal protein S4 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rps4 PE=3 SV=1 29 146 3.0E-22
sp|A9A436|RS4_NITMS 30S ribosomal protein S4 OS=Nitrosopumilus maritimus (strain SCM1) GN=rps4 PE=3 SV=1 3 160 6.0E-22
sp|A3CWH7|RS4_METMJ 30S ribosomal protein S4 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps4 PE=3 SV=1 3 162 9.0E-22
sp|A4WM27|RS4_PYRAR 30S ribosomal protein S4 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps4 PE=3 SV=1 29 146 2.0E-21
sp|A1RT03|RS4_PYRIL 30S ribosomal protein S4 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps4 PE=3 SV=1 29 156 2.0E-21
sp|A0RY02|RS4_CENSY 30S ribosomal protein S4 OS=Cenarchaeum symbiosum (strain A) GN=rps4 PE=3 SV=1 3 164 3.0E-21
sp|A3MUS9|RS4_PYRCJ 30S ribosomal protein S4 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps4 PE=3 SV=1 29 146 6.0E-21
sp|A4YIN4|RS4_METS5 30S ribosomal protein S4 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps4 PE=3 SV=1 3 162 9.0E-19
sp|Q921Y2|IMP3_MOUSE U3 small nucleolar ribonucleoprotein protein IMP3 OS=Mus musculus GN=Imp3 PE=2 SV=1 25 146 2.0E-10
sp|Q3T0M3|IMP3_BOVIN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Bos taurus GN=IMP3 PE=2 SV=1 25 146 9.0E-10
sp|B9MKF4|RS4_CALBD 30S ribosomal protein S4 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsD PE=3 SV=1 4 160 6.0E-09
sp|A4XLQ3|RS4_CALS8 30S ribosomal protein S4 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsD PE=3 SV=1 4 146 2.0E-08
sp|O13835|IMP3_SCHPO U3 small nucleolar ribonucleoprotein protein imp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp3 PE=3 SV=1 32 146 2.0E-08
sp|Q9NV31|IMP3_HUMAN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Homo sapiens GN=IMP3 PE=1 SV=1 25 146 4.0E-08
sp|C0ZHK9|RS4_BREBN 30S ribosomal protein S4 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpsD PE=3 SV=1 30 147 5.0E-08
sp|P32899|IMP3_YEAST U3 small nucleolar ribonucleoprotein protein IMP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP3 PE=1 SV=1 25 156 7.0E-08
sp|Q74K05|RS4_LACJO 30S ribosomal protein S4 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsD PE=3 SV=1 30 148 3.0E-07
sp|Q042M7|RS4_LACGA 30S ribosomal protein S4 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsD PE=3 SV=2 30 148 3.0E-07
sp|A0T0H2|RR4_PHATC 30S ribosomal protein S4, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rps4 PE=3 SV=1 94 149 7.0E-07
sp|Q03EN4|RS4_PEDPA 30S ribosomal protein S4 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsD PE=3 SV=1 30 148 8.0E-07
sp|Q2LQD0|RS4_SYNAS 30S ribosomal protein S4 OS=Syntrophus aciditrophicus (strain SB) GN=rpsD PE=3 SV=1 102 148 8.0E-07
sp|Q2RFS5|RS4_MOOTA 30S ribosomal protein S4 OS=Moorella thermoacetica (strain ATCC 39073) GN=rpsD PE=3 SV=1 4 147 2.0E-06
sp|Q8A4A1|RS4_BACTN 30S ribosomal protein S4 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsD PE=3 SV=1 30 147 2.0E-06
sp|Q64NN4|RS4_BACFR 30S ribosomal protein S4 OS=Bacteroides fragilis (strain YCH46) GN=rpsD PE=3 SV=1 30 147 4.0E-06
sp|Q5L8D5|RS4_BACFN 30S ribosomal protein S4 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpsD PE=3 SV=1 30 147 4.0E-06
sp|Q04B92|RS4_LACDB 30S ribosomal protein S4 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpsD PE=3 SV=2 30 148 5.0E-06
sp|Q1GAV4|RS4_LACDA 30S ribosomal protein S4 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpsD PE=3 SV=1 30 148 5.0E-06
sp|B6YQ61|RS4_AZOPC 30S ribosomal protein S4 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rpsD PE=3 SV=1 102 147 6.0E-06
sp|A6LEG6|RS4_PARD8 30S ribosomal protein S4 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsD PE=3 SV=2 30 147 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0019843 rRNA binding Yes
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1953
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5282
Ophiocordyceps australis map64 (Brazil) OphauB2|5046
Ophiocordyceps camponoti-floridani Ophcf2|06132
Ophiocordyceps camponoti-rufipedis Ophun1|4422 (this protein)
Ophiocordyceps kimflemingae Ophio5|5021
Ophiocordyceps subramaniannii Hirsu2|2101

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4422
MPPRAYSKTSRTPRRPFEAARLDSELKLVGEYGLRNKREVWRVGLTLSKIRRAARQLLTLDEKDPKRLFEGNALI
RRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDS
QKHIDFSLKSPFGSGRAGRVKRKKAKAAEAAAGGEEEEEDE*
Coding >Ophun1|4422
ATGCCTCCCCGCGCCTATTCCAAAACCTCTCGTACCCCCCGCAGACCCTTCGAGGCTGCCCGACTTGACTCTGAG
TTGAAGCTCGTCGGAGAATATGGTCTGCGCAACAAGCGTGAGGTCTGGCGCGTCGGCCTGACGCTGTCCAAGATT
CGTCGTGCTGCCCGTCAGCTTCTTACCCTCGACGAAAAGGACCCCAAGCGTCTCTTTGAAGGCAATGCCCTCATT
CGCCGTCTGGTCCGCGTGGGCGTCCTCGACGAGTCTCGCATGAAGCTCGATTACGTCCTGGCCCTCAAGATTGAG
GATTTCCTCGAGCGTCGTCTGCAGACGTGCGTCTACAAGCTCGGCCTCGCAAAGTCCATCCACCACGCTCGCGTC
CTCATCCGTCAGCGCCACATCCGCGTCGGCAAGCAAATCGTCAACGTCCCCTCCTTCATCGTCCGTCTCGACTCT
CAGAAGCACATCGACTTCTCCCTCAAGTCGCCCTTCGGAAGCGGTCGCGCTGGCCGCGTCAAGAGAAAGAAGGCC
AAGGCTGCCGAGGCTGCTGCCGGAGGCGAGGAGGAGGAAGAGGACGAGTAG
Transcript >Ophun1|4422
ATGCCTCCCCGCGCCTATTCCAAAACCTCTCGTACCCCCCGCAGACCCTTCGAGGCTGCCCGACTTGACTCTGAG
TTGAAGCTCGTCGGAGAATATGGTCTGCGCAACAAGCGTGAGGTCTGGCGCGTCGGCCTGACGCTGTCCAAGATT
CGTCGTGCTGCCCGTCAGCTTCTTACCCTCGACGAAAAGGACCCCAAGCGTCTCTTTGAAGGCAATGCCCTCATT
CGCCGTCTGGTCCGCGTGGGCGTCCTCGACGAGTCTCGCATGAAGCTCGATTACGTCCTGGCCCTCAAGATTGAG
GATTTCCTCGAGCGTCGTCTGCAGACGTGCGTCTACAAGCTCGGCCTCGCAAAGTCCATCCACCACGCTCGCGTC
CTCATCCGTCAGCGCCACATCCGCGTCGGCAAGCAAATCGTCAACGTCCCCTCCTTCATCGTCCGTCTCGACTCT
CAGAAGCACATCGACTTCTCCCTCAAGTCGCCCTTCGGAAGCGGTCGCGCTGGCCGCGTCAAGAGAAAGAAGGCC
AAGGCTGCCGAGGCTGCTGCCGGAGGCGAGGAGGAGGAAGAGGACGAGTAG
Gene >Ophun1|4422
ATGCCTCCCCGCGCCTATTCCAAAACCTCTCGTACCCCCCGCAGACCCTTCGAGGCTGCCCGACTGTCAGTATCA
CCGGCCACTGAGCACGAGCTTGCCTCTGCTCAAGTCGATTGTGATCGTCCGACTGACAGGTGCGCGGGACAGTGA
CTCTGAGTTGAAGCTCGTCGGAGAATATGGTCTGCGCAACAAGCGTGAGGTCTGGCGCGTCGGCCTGACGCTGTC
CAAGATTCGTCGTGCTGCCCGGTAAGAATGCCTCGCTGATGCAGTGGCGGCCTCGTAACTAACGGCTTCGCAGTC
AGCTTCTTACCCTCGACGAAAAGGACCCCAAGCGTCTCTTTGAAGGCAATGCCCTCATTCGCCGTCTGGTCCGCG
TGGGCGTCCTCGACGAGTCTCGCATGAAGCTCGATTACGTCCTGGCCCTCAAGATTGAGGATTTCCTCGAGCGTC
GTCTGCAGACGTGCGTCTACAAGCTCGGCCTCGCAAAGTCCATCCACCACGCTCGCGTCCTCATCCGTCAGCGCC
ACATCCGCGTCGGCAAGCAAATCGTCAACGTCCCCTCCTTCATCGTCCGTCTCGACTCTCAGAAGCACATCGACT
TCTCCCTCAAGTCGCCCTTCGGAAGCGGTCGCGCTGGCCGCGTCAAGAGAAAGAAGGCCAAGGCTGCCGAGGCTG
CTGCCGGAGGCGAGGAGGAGGAAGAGGACGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail