Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4417
Gene name
LocationContig_407:7273..9606
Strand-
Gene length (bp)2333
Transcript length (bp)2274
Coding sequence length (bp)2274
Protein length (aa) 758

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00856 SET SET domain 5.0E-09 183 225

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8C9|SET9_GIBZE Histone-lysine N-methyltransferase SET9 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SET9 PE=3 SV=1 3 674 0.0E+00
sp|Q7SBJ9|SET9_NEUCR Histone-lysine N-methyltransferase set9 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hlm-1 PE=3 SV=2 5 746 2.0E-176
sp|Q2H8D5|SET9_CHAGB Histone-lysine N-methyltransferase SET9 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SET9 PE=3 SV=1 3 648 2.0E-174
sp|Q5AZY3|SET9_EMENI Histone-lysine N-methyltransferase set9 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=set9 PE=3 SV=1 5 627 4.0E-135
sp|Q0C9E6|SET9_ASPTN Histone-lysine N-methyltransferase set9 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=set9 PE=3 SV=1 5 621 8.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8C9|SET9_GIBZE Histone-lysine N-methyltransferase SET9 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SET9 PE=3 SV=1 3 674 0.0E+00
sp|Q7SBJ9|SET9_NEUCR Histone-lysine N-methyltransferase set9 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hlm-1 PE=3 SV=2 5 746 2.0E-176
sp|Q2H8D5|SET9_CHAGB Histone-lysine N-methyltransferase SET9 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SET9 PE=3 SV=1 3 648 2.0E-174
sp|Q5AZY3|SET9_EMENI Histone-lysine N-methyltransferase set9 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=set9 PE=3 SV=1 5 627 4.0E-135
sp|Q0C9E6|SET9_ASPTN Histone-lysine N-methyltransferase set9 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=set9 PE=3 SV=1 5 621 8.0E-129
sp|Q2TZH4|SET9_ASPOR Histone-lysine N-methyltransferase set9 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=set9 PE=3 SV=1 5 621 1.0E-127
sp|Q0U3A4|SET9_PHANO Histone-lysine N-methyltransferase SET9 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SET9 PE=3 SV=1 6 251 6.0E-95
sp|Q4X1W8|SET9_ASPFU Histone-lysine N-methyltransferase set9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=set9 PE=3 SV=1 1 251 3.0E-90
sp|Q9USK2|SET9_SCHPO Histone-lysine N-methyltransferase set9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set9 PE=1 SV=1 5 249 5.0E-42
sp|Q4X1W8|SET9_ASPFU Histone-lysine N-methyltransferase set9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=set9 PE=3 SV=1 477 623 7.0E-32
sp|Q5U3H2|SV421_DANRE Histone-lysine N-methyltransferase SUV420H1 OS=Danio rerio GN=suv420h1 PE=2 SV=2 9 244 1.0E-29
sp|Q1E9C0|SET9_COCIM Histone-lysine N-methyltransferase SET9 OS=Coccidioides immitis (strain RS) GN=SET9 PE=3 SV=1 526 621 1.0E-28
sp|A0JMZ4|SV422_XENLA Histone-lysine N-methyltransferase SUV420H2 OS=Xenopus laevis GN=suv420h2 PE=2 SV=1 8 242 6.0E-28
sp|Q6GP17|S421A_XENLA Histone-lysine N-methyltransferase SUV420H1-A OS=Xenopus laevis GN=suv420h1-a PE=2 SV=1 9 244 6.0E-26
sp|Q86Y97|SV422_HUMAN Histone-lysine N-methyltransferase SUV420H2 OS=Homo sapiens GN=SUV420H2 PE=1 SV=1 8 242 1.0E-25
sp|P0C2N6|SV422_RAT Histone-lysine N-methyltransferase SUV420H2 OS=Rattus norvegicus GN=Suv420h2 PE=2 SV=1 8 281 2.0E-25
sp|Q6Q783|SV422_MOUSE Histone-lysine N-methyltransferase SUV420H2 OS=Mus musculus GN=Suv420h2 PE=1 SV=1 8 281 3.0E-25
sp|Q29RP8|SV421_BOVIN Histone-lysine N-methyltransferase SUV420H1 OS=Bos taurus GN=SUV420H1 PE=2 SV=1 96 244 7.0E-25
sp|Q3U8K7|SV421_MOUSE Histone-lysine N-methyltransferase SUV420H1 OS=Mus musculus GN=Suv420h1 PE=1 SV=2 96 244 8.0E-25
sp|P0C2N5|SV421_RAT Histone-lysine N-methyltransferase SUV420H1 OS=Rattus norvegicus GN=Suv420h1 PE=3 SV=1 96 244 9.0E-25
sp|Q4FZB7|SV421_HUMAN Histone-lysine N-methyltransferase SUV420H1 OS=Homo sapiens GN=SUV420H1 PE=1 SV=4 96 244 1.0E-24
sp|Q9W5E0|SUV42_DROME Histone-lysine N-methyltransferase Suv4-20 OS=Drosophila melanogaster GN=Hmt4-20 PE=1 SV=1 13 244 7.0E-24
sp|Q5RJX8|S421B_XENLA Histone-lysine N-methyltransferase SUV420H1-B OS=Xenopus laevis GN=suv420h1-b PE=2 SV=1 9 244 7.0E-24
sp|Q09265|SUV42_CAEEL Histone-lysine N-methyltransferase Suv4-20 OS=Caenorhabditis elegans GN=set-4 PE=3 SV=1 9 278 2.0E-22
sp|A8WTV9|SUV42_CAEBR Histone-lysine N-methyltransferase Suv4-20 OS=Caenorhabditis briggsae GN=set-4 PE=3 SV=1 9 242 3.0E-22
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4417
MPAHRKRRLTLAQLAAYDDILTDALVDRVFYWTSVPKNRSSYLPSRGVSEDAITAIIRDDLVVARDLETAKNKLL
ATPGLRRFHDGLQTAEERDDFRRHLLRYLHIYLPDCPWEVGSTNRYTIVSHEACVTARRPIGRNEAIRYLAGVQV
NITPEEEKEMAVRKKDFSIVVSSRSKSASLFMGPARFANHDCMANARLVTKGHGGIEIIATRPIAVGEEITVSYG
ENYFGDDNRECLCRTCETRLCNGWLPENADGSSAGVAKPVEPEGAYSYSLRRRPRDVSSSSSAAPSRTPSVTPVI
RPRSYRSRAMGSRLSLADEPSLAAASLPSTRAVAPRVAGRKRPVDVLATPPVTPAKRLLEAAAQRNMASDVSSGD
VVVETDGTASEKASPGMDVTSPEKDSPETDVTSPDKQSPEIDVTSPEKERSDIDGVPLVSNEPALKREDRDAAAL
ARTIPASVQPEGASEVPLRTTAPDSDSGSPRGDESRPVATSIETIEDSQGSLAAGEELQGDSAPRRRKYRRRQVF
IKQATPPARLRVPGDYVLTRHLLSEPEMAWIQCTNCGSHFVQQNAYVTRASCPRCERHSKLYGYVWPKTDRQGPS
DREERVLDHRTVHRFLNSRDEQLARGRKPPAEDLTVEVVEKAPRGRKRGKRLAAVGMSKQTVVARRRGRKRKLQR
EETEEDEDEKDDDEEDEGDEDEDEDEQDDDEEDDDQEDRDFVVAKRVKLAALGDGQRMLRRSGRARRTSHRAVPL
GQKVSAQ*
Coding >Ophun1|4417
ATGCCGGCGCATCGGAAGCGACGCCTGACTTTGGCTCAACTGGCTGCTTACGATGATATTCTTACCGACGCCCTC
GTCGATCGTGTCTTCTACTGGACCAGCGTTCCAAAGAACCGGTCGTCTTACCTGCCTTCGCGCGGCGTCAGCGAG
GACGCCATCACGGCCATTATTCGCGACGATCTAGTTGTCGCCAGGGACTTGGAAACCGCCAAGAATAAATTGCTG
GCCACACCTGGCCTCCGCCGTTTTCACGATGGTCTTCAAACGGCCGAGGAACGTGACGACTTCCGCCGACATTTG
CTGCGCTATCTGCACATCTATCTACCCGACTGCCCCTGGGAAGTGGGCTCGACGAACCGGTACACCATCGTCTCG
CACGAGGCCTGCGTCACGGCCCGACGGCCCATCGGTCGCAACGAGGCGATCCGGTACCTGGCTGGCGTGCAGGTC
AACATCACGCCCGAGGAGGAGAAGGAGATGGCTGTGCGCAAGAAGGACTTCAGCATCGTCGTCAGTTCCCGCAGC
AAGTCGGCTAGCCTCTTCATGGGACCAGCTCGGTTCGCGAACCACGACTGCATGGCCAACGCCCGCCTGGTGACC
AAGGGTCATGGCGGCATCGAGATCATCGCCACTCGGCCCATTGCCGTCGGCGAAGAGATTACTGTCAGCTACGGC
GAGAACTATTTCGGCGACGACAACCGCGAGTGTTTGTGCCGCACCTGCGAGACGAGGCTGTGCAACGGCTGGCTT
CCCGAGAACGCCGACGGCTCCTCGGCCGGTGTTGCGAAGCCGGTTGAGCCAGAGGGAGCTTACTCGTACTCCTTG
CGCCGCCGGCCGCGAGACGTCAGCAGCAGCAGCAGCGCGGCGCCGTCCAGGACGCCCTCGGTCACGCCCGTCATC
CGGCCGCGCTCCTACAGATCGAGGGCCATGGGTTCGAGGCTGAGTCTGGCCGACGAGCCGAGCTTGGCTGCCGCG
TCTCTGCCGTCTACACGTGCCGTCGCTCCTCGTGTCGCTGGACGGAAGCGGCCCGTCGATGTCTTGGCCACGCCG
CCGGTGACTCCGGCTAAGAGGCTTCTTGAGGCGGCGGCGCAACGGAACATGGCGTCGGACGTCAGCAGCGGCGAC
GTCGTTGTCGAGACTGATGGGACTGCTTCGGAGAAGGCCAGTCCCGGCATGGACGTGACGTCTCCGGAAAAGGAC
AGTCCGGAGACGGACGTTACGTCTCCTGATAAGCAGAGTCCTGAGATTGACGTGACGTCTCCTGAAAAGGAGAGG
TCCGATATTGACGGCGTCCCTCTTGTGTCTAATGAGCCGGCATTGAAACGAGAAGACCGCGATGCTGCCGCCTTG
GCTCGAACGATTCCTGCCTCGGTCCAGCCGGAGGGCGCGTCCGAAGTCCCGTTGAGGACGACGGCTCCTGATTCA
GACTCGGGCTCGCCGCGTGGCGATGAGTCGAGGCCGGTCGCCACGAGTATCGAAACGATAGAGGACAGCCAAGGA
TCGCTAGCCGCGGGAGAGGAGCTACAGGGCGACTCGGCGCCTCGAAGGCGCAAATATCGACGCCGACAGGTCTTC
ATCAAGCAAGCCACGCCACCGGCGCGTCTCCGCGTGCCGGGAGACTACGTGCTGACGCGTCACCTGTTGTCGGAG
CCCGAGATGGCGTGGATTCAGTGCACCAACTGCGGCTCCCACTTCGTGCAGCAAAACGCCTACGTGACGCGGGCG
TCGTGCCCGCGCTGTGAGCGGCACTCGAAGCTGTACGGCTACGTGTGGCCCAAGACGGACCGGCAGGGACCCTCA
GATCGGGAGGAGCGAGTGCTGGATCACAGGACTGTGCACCGCTTCCTCAACTCACGCGATGAGCAACTGGCCAGG
GGTCGGAAGCCCCCGGCAGAGGATCTGACGGTTGAGGTCGTCGAGAAGGCGCCGCGCGGGCGGAAACGAGGAAAG
AGGTTGGCGGCTGTGGGCATGTCGAAGCAGACGGTGGTGGCCAGGAGGCGAGGGAGGAAGAGGAAGTTGCAGCGG
GAGGAGACGGAGGAGGATGAAGATGAGAAGGACGATGATGAGGAAGACGAGGGAGACGAGGACGAGGATGAAGAC
GAACAAGACGACGATGAGGAAGACGACGACCAAGAGGATCGGGACTTTGTGGTGGCCAAAAGGGTCAAGCTCGCG
GCTCTGGGAGACGGGCAGAGGATGCTGAGACGCAGCGGTCGTGCGAGAAGAACCAGCCACAGGGCGGTTCCTCTT
GGACAAAAGGTTTCGGCACAATAG
Transcript >Ophun1|4417
ATGCCGGCGCATCGGAAGCGACGCCTGACTTTGGCTCAACTGGCTGCTTACGATGATATTCTTACCGACGCCCTC
GTCGATCGTGTCTTCTACTGGACCAGCGTTCCAAAGAACCGGTCGTCTTACCTGCCTTCGCGCGGCGTCAGCGAG
GACGCCATCACGGCCATTATTCGCGACGATCTAGTTGTCGCCAGGGACTTGGAAACCGCCAAGAATAAATTGCTG
GCCACACCTGGCCTCCGCCGTTTTCACGATGGTCTTCAAACGGCCGAGGAACGTGACGACTTCCGCCGACATTTG
CTGCGCTATCTGCACATCTATCTACCCGACTGCCCCTGGGAAGTGGGCTCGACGAACCGGTACACCATCGTCTCG
CACGAGGCCTGCGTCACGGCCCGACGGCCCATCGGTCGCAACGAGGCGATCCGGTACCTGGCTGGCGTGCAGGTC
AACATCACGCCCGAGGAGGAGAAGGAGATGGCTGTGCGCAAGAAGGACTTCAGCATCGTCGTCAGTTCCCGCAGC
AAGTCGGCTAGCCTCTTCATGGGACCAGCTCGGTTCGCGAACCACGACTGCATGGCCAACGCCCGCCTGGTGACC
AAGGGTCATGGCGGCATCGAGATCATCGCCACTCGGCCCATTGCCGTCGGCGAAGAGATTACTGTCAGCTACGGC
GAGAACTATTTCGGCGACGACAACCGCGAGTGTTTGTGCCGCACCTGCGAGACGAGGCTGTGCAACGGCTGGCTT
CCCGAGAACGCCGACGGCTCCTCGGCCGGTGTTGCGAAGCCGGTTGAGCCAGAGGGAGCTTACTCGTACTCCTTG
CGCCGCCGGCCGCGAGACGTCAGCAGCAGCAGCAGCGCGGCGCCGTCCAGGACGCCCTCGGTCACGCCCGTCATC
CGGCCGCGCTCCTACAGATCGAGGGCCATGGGTTCGAGGCTGAGTCTGGCCGACGAGCCGAGCTTGGCTGCCGCG
TCTCTGCCGTCTACACGTGCCGTCGCTCCTCGTGTCGCTGGACGGAAGCGGCCCGTCGATGTCTTGGCCACGCCG
CCGGTGACTCCGGCTAAGAGGCTTCTTGAGGCGGCGGCGCAACGGAACATGGCGTCGGACGTCAGCAGCGGCGAC
GTCGTTGTCGAGACTGATGGGACTGCTTCGGAGAAGGCCAGTCCCGGCATGGACGTGACGTCTCCGGAAAAGGAC
AGTCCGGAGACGGACGTTACGTCTCCTGATAAGCAGAGTCCTGAGATTGACGTGACGTCTCCTGAAAAGGAGAGG
TCCGATATTGACGGCGTCCCTCTTGTGTCTAATGAGCCGGCATTGAAACGAGAAGACCGCGATGCTGCCGCCTTG
GCTCGAACGATTCCTGCCTCGGTCCAGCCGGAGGGCGCGTCCGAAGTCCCGTTGAGGACGACGGCTCCTGATTCA
GACTCGGGCTCGCCGCGTGGCGATGAGTCGAGGCCGGTCGCCACGAGTATCGAAACGATAGAGGACAGCCAAGGA
TCGCTAGCCGCGGGAGAGGAGCTACAGGGCGACTCGGCGCCTCGAAGGCGCAAATATCGACGCCGACAGGTCTTC
ATCAAGCAAGCCACGCCACCGGCGCGTCTCCGCGTGCCGGGAGACTACGTGCTGACGCGTCACCTGTTGTCGGAG
CCCGAGATGGCGTGGATTCAGTGCACCAACTGCGGCTCCCACTTCGTGCAGCAAAACGCCTACGTGACGCGGGCG
TCGTGCCCGCGCTGTGAGCGGCACTCGAAGCTGTACGGCTACGTGTGGCCCAAGACGGACCGGCAGGGACCCTCA
GATCGGGAGGAGCGAGTGCTGGATCACAGGACTGTGCACCGCTTCCTCAACTCACGCGATGAGCAACTGGCCAGG
GGTCGGAAGCCCCCGGCAGAGGATCTGACGGTTGAGGTCGTCGAGAAGGCGCCGCGCGGGCGGAAACGAGGAAAG
AGGTTGGCGGCTGTGGGCATGTCGAAGCAGACGGTGGTGGCCAGGAGGCGAGGGAGGAAGAGGAAGTTGCAGCGG
GAGGAGACGGAGGAGGATGAAGATGAGAAGGACGATGATGAGGAAGACGAGGGAGACGAGGACGAGGATGAAGAC
GAACAAGACGACGATGAGGAAGACGACGACCAAGAGGATCGGGACTTTGTGGTGGCCAAAAGGGTCAAGCTCGCG
GCTCTGGGAGACGGGCAGAGGATGCTGAGACGCAGCGGTCGTGCGAGAAGAACCAGCCACAGGGCGGTTCCTCTT
GGACAAAAGGTTTCGGCACAATAG
Gene >Ophun1|4417
ATGCCGGCGCATCGGAAGCGACGCCTGACTTTGGCTCAACTGGCTGCTTACGATGATATTCTTACCGACGCCCTC
GTCGATCGTGTGAGTCCCTTTGCGGCTGCTTTATCCCGGAGATTCTGGGCTGCTGACGGGACAAATAGGTCTTCT
ACTGGACCAGCGTTCCAAAGAACCGGTCGTCTTACCTGCCTTCGCGCGGCGTCAGCGAGGACGCCATCACGGCCA
TTATTCGCGACGATCTAGTTGTCGCCAGGGACTTGGAAACCGCCAAGAATAAATTGCTGGCCACACCTGGCCTCC
GCCGTTTTCACGATGGTCTTCAAACGGCCGAGGAACGTGACGACTTCCGCCGACATTTGCTGCGCTATCTGCACA
TCTATCTACCCGACTGCCCCTGGGAAGTGGGCTCGACGAACCGGTACACCATCGTCTCGCACGAGGCCTGCGTCA
CGGCCCGACGGCCCATCGGTCGCAACGAGGCGATCCGGTACCTGGCTGGCGTGCAGGTCAACATCACGCCCGAGG
AGGAGAAGGAGATGGCTGTGCGCAAGAAGGACTTCAGCATCGTCGTCAGTTCCCGCAGCAAGTCGGCTAGCCTCT
TCATGGGACCAGCTCGGTTCGCGAACCACGACTGCATGGCCAACGCCCGCCTGGTGACCAAGGGTCATGGCGGCA
TCGAGATCATCGCCACTCGGCCCATTGCCGTCGGCGAAGAGATTACTGTCAGCTACGGCGAGAACTATTTCGGCG
ACGACAACCGCGAGTGTTTGTGCCGCACCTGCGAGACGAGGCTGTGCAACGGCTGGCTTCCCGAGAACGCCGACG
GCTCCTCGGCCGGTGTTGCGAAGCCGGTTGAGCCAGAGGGAGCTTACTCGTACTCCTTGCGCCGCCGGCCGCGAG
ACGTCAGCAGCAGCAGCAGCGCGGCGCCGTCCAGGACGCCCTCGGTCACGCCCGTCATCCGGCCGCGCTCCTACA
GATCGAGGGCCATGGGTTCGAGGCTGAGTCTGGCCGACGAGCCGAGCTTGGCTGCCGCGTCTCTGCCGTCTACAC
GTGCCGTCGCTCCTCGTGTCGCTGGACGGAAGCGGCCCGTCGATGTCTTGGCCACGCCGCCGGTGACTCCGGCTA
AGAGGCTTCTTGAGGCGGCGGCGCAACGGAACATGGCGTCGGACGTCAGCAGCGGCGACGTCGTTGTCGAGACTG
ATGGGACTGCTTCGGAGAAGGCCAGTCCCGGCATGGACGTGACGTCTCCGGAAAAGGACAGTCCGGAGACGGACG
TTACGTCTCCTGATAAGCAGAGTCCTGAGATTGACGTGACGTCTCCTGAAAAGGAGAGGTCCGATATTGACGGCG
TCCCTCTTGTGTCTAATGAGCCGGCATTGAAACGAGAAGACCGCGATGCTGCCGCCTTGGCTCGAACGATTCCTG
CCTCGGTCCAGCCGGAGGGCGCGTCCGAAGTCCCGTTGAGGACGACGGCTCCTGATTCAGACTCGGGCTCGCCGC
GTGGCGATGAGTCGAGGCCGGTCGCCACGAGTATCGAAACGATAGAGGACAGCCAAGGATCGCTAGCCGCGGGAG
AGGAGCTACAGGGCGACTCGGCGCCTCGAAGGCGCAAATATCGACGCCGACAGGTCTTCATCAAGCAAGCCACGC
CACCGGCGCGTCTCCGCGTGCCGGGAGACTACGTGCTGACGCGTCACCTGTTGTCGGAGCCCGAGATGGCGTGGA
TTCAGTGCACCAACTGCGGCTCCCACTTCGTGCAGCAAAACGCCTACGTGACGCGGGCGTCGTGCCCGCGCTGTG
AGCGGCACTCGAAGCTGTACGGCTACGTGTGGCCCAAGACGGACCGGCAGGGACCCTCAGATCGGGAGGAGCGAG
TGCTGGATCACAGGACTGTGCACCGCTTCCTCAACTCACGCGATGAGCAACTGGCCAGGGGTCGGAAGCCCCCGG
CAGAGGATCTGACGGTTGAGGTCGTCGAGAAGGCGCCGCGCGGGCGGAAACGAGGAAAGAGGTTGGCGGCTGTGG
GCATGTCGAAGCAGACGGTGGTGGCCAGGAGGCGAGGGAGGAAGAGGAAGTTGCAGCGGGAGGAGACGGAGGAGG
ATGAAGATGAGAAGGACGATGATGAGGAAGACGAGGGAGACGAGGACGAGGATGAAGACGAACAAGACGACGATG
AGGAAGACGACGACCAAGAGGATCGGGACTTTGTGGTGGCCAAAAGGGTCAAGCTCGCGGCTCTGGGAGACGGGC
AGAGGATGCTGAGACGCAGCGGTCGTGCGAGAAGAACCAGCCACAGGGCGGTTCCTCTTGGACAAAAGGTTTCGG
CACAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail