Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4411
Gene name
LocationContig_406:8866..10138
Strand-
Gene length (bp)1272
Transcript length (bp)1074
Coding sequence length (bp)1074
Protein length (aa) 358

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11927 DUF3445 Protein of unknown function (DUF3445) 1.2E-70 76 313

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup814
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2837
Ophiocordyceps australis map64 (Brazil) OphauB2|6810
Ophiocordyceps camponoti-floridani Ophcf2|05411
Ophiocordyceps camponoti-rufipedis Ophun1|4411 (this protein)
Ophiocordyceps kimflemingae Ophio5|5851
Ophiocordyceps subramaniannii Hirsu2|3746
Ophiocordyceps subramaniannii Hirsu2|7391

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4411
MLLTAVVAAVVAALVYRRFFKALDGSLRLYLLKLTAATRRGSWKPDIVPLEGWDWTAEEPRKFRPYKPVYHMGMG
LRADTPSELITIDRGYLDRVNIRRNLLCEHGNMLHGCAAGGEDGVREVYEYLMRQYLPARFPTIFALTDKGRQIR
NKVTGRTHPTAMADAEASLRAIGETVEEDMFLVRETAGCHRSVAFICCFPAGFNPSTKLDKVLEDIHGPVPSYER
IGPSMERFFGKLQVGKSVKRLNWVIQTHDRLLVPEPHDAPHPGVSETGEIDVEKTFLRVELQTLTRLPITRDILF
SFKTYLYPIRQIKEEGSGPDLAAAVEGLRLGNAPGMWAYKAGAQWAKTVCGYLRGED*
Coding >Ophun1|4411
ATGCTACTGACGGCCGTCGTAGCCGCGGTAGTCGCCGCTTTGGTCTATAGGCGCTTTTTCAAGGCACTTGATGGT
TCTTTACGACTTTATCTGCTTAAGCTGACGGCCGCAACGCGTCGAGGTTCATGGAAGCCGGATATTGTTCCCCTC
GAGGGCTGGGATTGGACGGCGGAAGAGCCGCGCAAGTTTCGTCCCTATAAGCCCGTCTATCACATGGGCATGGGT
CTCCGAGCCGATACGCCCTCGGAACTCATCACCATCGACAGGGGCTACCTCGATAGGGTCAATATCCGGCGCAAT
CTGCTTTGCGAGCACGGCAACATGCTCCATGGCTGCGCTGCCGGAGGAGAAGACGGCGTCCGCGAGGTGTACGAA
TACCTTATGCGTCAATACCTGCCCGCGCGCTTCCCGACCATATTCGCCCTGACCGACAAGGGCCGACAGATCCGC
AACAAGGTGACGGGCAGGACGCATCCGACGGCCATGGCAGATGCCGAGGCCTCGCTGCGTGCCATCGGAGAGACT
GTCGAGGAGGACATGTTTCTGGTGCGCGAGACGGCTGGCTGTCATCGATCTGTTGCCTTTATCTGTTGCTTCCCC
GCTGGCTTCAACCCGTCGACCAAGCTGGACAAGGTGCTCGAGGATATCCACGGGCCTGTGCCGTCGTATGAGCGC
ATCGGTCCTAGCATGGAGCGCTTCTTCGGAAAGCTTCAAGTCGGCAAGAGCGTCAAGCGTCTGAATTGGGTGATA
CAGACTCACGATCGATTGCTCGTGCCTGAGCCTCATGACGCGCCGCACCCTGGCGTGAGCGAGACGGGCGAGATA
GACGTAGAAAAGACGTTCCTGCGAGTCGAGCTACAGACGCTGACGAGGCTGCCAATCACACGCGACATACTCTTC
TCCTTCAAGACGTATCTGTATCCGATTCGGCAGATCAAGGAAGAGGGCTCGGGTCCGGATCTTGCGGCGGCCGTC
GAGGGCCTGCGGCTGGGAAACGCGCCGGGCATGTGGGCGTACAAGGCGGGCGCGCAGTGGGCAAAGACTGTTTGT
GGCTATCTTCGAGGCGAAGATTAG
Transcript >Ophun1|4411
ATGCTACTGACGGCCGTCGTAGCCGCGGTAGTCGCCGCTTTGGTCTATAGGCGCTTTTTCAAGGCACTTGATGGT
TCTTTACGACTTTATCTGCTTAAGCTGACGGCCGCAACGCGTCGAGGTTCATGGAAGCCGGATATTGTTCCCCTC
GAGGGCTGGGATTGGACGGCGGAAGAGCCGCGCAAGTTTCGTCCCTATAAGCCCGTCTATCACATGGGCATGGGT
CTCCGAGCCGATACGCCCTCGGAACTCATCACCATCGACAGGGGCTACCTCGATAGGGTCAATATCCGGCGCAAT
CTGCTTTGCGAGCACGGCAACATGCTCCATGGCTGCGCTGCCGGAGGAGAAGACGGCGTCCGCGAGGTGTACGAA
TACCTTATGCGTCAATACCTGCCCGCGCGCTTCCCGACCATATTCGCCCTGACCGACAAGGGCCGACAGATCCGC
AACAAGGTGACGGGCAGGACGCATCCGACGGCCATGGCAGATGCCGAGGCCTCGCTGCGTGCCATCGGAGAGACT
GTCGAGGAGGACATGTTTCTGGTGCGCGAGACGGCTGGCTGTCATCGATCTGTTGCCTTTATCTGTTGCTTCCCC
GCTGGCTTCAACCCGTCGACCAAGCTGGACAAGGTGCTCGAGGATATCCACGGGCCTGTGCCGTCGTATGAGCGC
ATCGGTCCTAGCATGGAGCGCTTCTTCGGAAAGCTTCAAGTCGGCAAGAGCGTCAAGCGTCTGAATTGGGTGATA
CAGACTCACGATCGATTGCTCGTGCCTGAGCCTCATGACGCGCCGCACCCTGGCGTGAGCGAGACGGGCGAGATA
GACGTAGAAAAGACGTTCCTGCGAGTCGAGCTACAGACGCTGACGAGGCTGCCAATCACACGCGACATACTCTTC
TCCTTCAAGACGTATCTGTATCCGATTCGGCAGATCAAGGAAGAGGGCTCGGGTCCGGATCTTGCGGCGGCCGTC
GAGGGCCTGCGGCTGGGAAACGCGCCGGGCATGTGGGCGTACAAGGCGGGCGCGCAGTGGGCAAAGACTGTTTGT
GGCTATCTTCGAGGCGAAGATTAG
Gene >Ophun1|4411
ATGCTACTGACGGCCGTCGTAGCCGCGGTAGTCGCCGCTTTGGTCTATAGGCGCTTTTTCAAGGCACTTGATGGT
TCTTTACGACTTTATCTGCTTAAGCTGACGGCCGCAACGCGTCGAGGTTCATGGAAGCCGGATATTGTTCCCCTC
GAGGGCTGGGATTGGACGGCGGAAGAGCCGCGCAAGTTTCGTCCCTATAAGCCCGTCTATCACATGGGCATGGGT
AAGAGGACTACCGTCGTCGTGGCGAATAAGTCTCGGTGTGCTGACGATGGTGACGAGTAGGTCTCCGAGCCGATA
CGCCCTCGGAACTCATCACCATCGACAGGGGCTACCTCGATAGGGTCAATATCCGGCGCAATCTGCTTTGCGAGC
ACGGCAACATGCTCCATGGCTGCGCTGCCGGAGGAGAAGACGGCGTCCGCGAGGTGTACGAATACCTTATGCGTC
AATACCTGCCCGCGCGCTTCCCGACCATATTCGCCCTGACCGACAAGGGCCGACAGATCCGCAACAAGGTGACGG
GCAGGACGCATCCGACGGCCATGGCAGATGCCGAGGCCTCGCTGCGTGCCATCGGAGAGACTGTCGAGGAGGACA
TGTTTCTGGTGCGCGAGACGGCTGGCTGTCATCGATCTGTTGCCTTTATCTGTTGCTTCCCCGCTGGCTTCAACC
CGTCGACCAAGCTGGACAAGGTGCTCGAGGATATCCACGGGCCTGTGCCGTCGTATGAGCGCATCGGTCCTAGCA
TGGAGCGCTTCTTCGGAAAGCTTCAAGTCGGCAAGAGCGTCAAGCGTCTGAATGTAAGTTCATCTTGGGGCCGGG
GGGGAGGTGGTTGATAGACTTGCTTGTGTAAGAGCTGACCTGCGATCTTGGATGATTAGTGGGTGATACAGACTC
ACGATCGATTGCTCGTGCCTGAGCCTCATGACGCGCCGCACCCTGGCGTGAGCGAGACGGGCGAGATAGACGTAG
AAAAGGTGAGCGAGAATGGAAAGCTCGTCGTCGTAGGCGATGTTTCTGACGTGCGTTTAGACGTTCCTGCGAGTC
GAGCTACAGACGCTGACGAGGCTGCCAATCACACGCGACATACTCTTCTCCTTCAAGACGTATCTGTATCCGATT
CGGCAGATCAAGGAAGAGGGCTCGGGTCCGGATCTTGCGGCGGCCGTCGAGGGCCTGCGGCTGGGAAACGCGCCG
GGCATGTGGGCGTACAAGGCGGGCGCGCAGTGGGCAAAGACTGTTTGTGGCTATCTTCGAGGCGAAGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail