Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4409
Gene name
LocationContig_406:287..3599
Strand+
Gene length (bp)3312
Transcript length (bp)3192
Coding sequence length (bp)3192
Protein length (aa) 1064

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06479 Ribonuc_2-5A Ribonuclease 2-5A 5.4E-41 931 1058
PF00069 Pkinase Protein kinase domain 4.0E-39 639 925
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.6E-19 640 921

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94537|PPK4_SCHPO Serine/threonine-protein kinase ppk4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk4 PE=3 SV=1 613 1057 5.0E-114
sp|P32361|IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRE1 PE=1 SV=2 561 1045 2.0E-108
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 629 1058 2.0E-86
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 600 1058 2.0E-86
sp|Q09499|IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans GN=ire-1 PE=1 SV=2 643 1058 3.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94537|PPK4_SCHPO Serine/threonine-protein kinase ppk4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk4 PE=3 SV=1 613 1057 5.0E-114
sp|P32361|IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRE1 PE=1 SV=2 561 1045 2.0E-108
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 629 1058 2.0E-86
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 600 1058 2.0E-86
sp|Q09499|IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans GN=ire-1 PE=1 SV=2 643 1058 3.0E-82
sp|Q76MJ5|ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens GN=ERN2 PE=1 SV=4 632 1060 7.0E-82
sp|Q9Z2E3|ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus GN=Ern2 PE=2 SV=2 632 1061 5.0E-80
sp|Q9C5S2|IRE1A_ARATH Serine/threonine-protein kinase/endoribonuclease IRE1a OS=Arabidopsis thaliana GN=IRE1A PE=1 SV=1 631 1059 4.0E-72
sp|Q55GJ2|IREA_DICDI Probable serine/threonine-protein kinase ireA OS=Dictyostelium discoideum GN=ireA PE=3 SV=1 630 1058 5.0E-71
sp|Q93VJ2|IRE1B_ARATH Serine/threonine-protein kinase/endoribonuclease IRE1b OS=Arabidopsis thaliana GN=IRE1B PE=2 SV=1 631 1055 7.0E-68
sp|Q559A2|IRLA_DICDI Probable serine/threonine-protein kinase irlA OS=Dictyostelium discoideum GN=irlA PE=3 SV=1 643 1052 7.0E-37
sp|Q557G1|IRLB_DICDI Probable serine/threonine-protein kinase irlB OS=Dictyostelium discoideum GN=irlB-1 PE=3 SV=1 643 948 3.0E-36
sp|Q55DJ9|IRLD_DICDI Probable serine/threonine-protein kinase irlD OS=Dictyostelium discoideum GN=irlD PE=3 SV=1 640 935 3.0E-35
sp|Q55DJ8|IRLC_DICDI Probable serine/threonine-protein kinase irlC OS=Dictyostelium discoideum GN=irlC PE=3 SV=1 630 935 6.0E-35
sp|Q9SF12|IRE1L_ARATH Inactive serine/threonine-protein kinase/endoribonuclease IRE1-like OS=Arabidopsis thaliana GN=At3g11870 PE=3 SV=1 559 1058 7.0E-33
sp|Q54IE8|IRLE_DICDI Probable serine/threonine-protein kinase irlE OS=Dictyostelium discoideum GN=irlE PE=3 SV=1 620 935 2.0E-32
sp|Q556Q3|IRLF_DICDI Probable serine/threonine-protein kinase irlF OS=Dictyostelium discoideum GN=irlF-1 PE=3 SV=1 643 1009 3.0E-32
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 643 925 5.0E-20
sp|P32361|IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRE1 PE=1 SV=2 18 377 9.0E-20
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 554 923 6.0E-19
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 565 923 1.0E-18
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 606 1048 1.0E-18
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 568 923 1.0E-18
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 643 925 7.0E-18
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 643 935 1.0E-17
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 643 924 2.0E-17
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 646 924 2.0E-17
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 677 923 5.0E-17
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 643 925 5.0E-17
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 677 923 5.0E-17
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 657 925 7.0E-17
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 657 925 9.0E-17
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 657 924 9.0E-17
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 657 925 1.0E-16
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 657 925 1.0E-16
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 657 924 1.0E-16
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 657 925 1.0E-16
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 687 925 1.0E-16
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 679 925 1.0E-16
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 679 925 1.0E-16
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 643 925 1.0E-16
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 679 924 1.0E-16
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 642 925 2.0E-16
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 642 925 2.0E-16
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 642 925 3.0E-16
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 642 925 3.0E-16
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 638 925 3.0E-16
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 656 925 4.0E-16
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 643 925 5.0E-16
sp|Q10292|MEK1_SCHPO Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mek1 PE=3 SV=1 658 935 5.0E-16
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 651 924 5.0E-16
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 643 925 6.0E-16
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 636 922 6.0E-16
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 643 925 6.0E-16
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 651 924 6.0E-16
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 656 925 6.0E-16
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 651 924 6.0E-16
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 679 925 7.0E-16
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 656 925 9.0E-16
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 587 925 1.0E-15
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 657 925 1.0E-15
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 682 925 1.0E-15
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 651 924 1.0E-15
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 682 925 2.0E-15
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 657 925 2.0E-15
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 656 925 2.0E-15
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 643 925 2.0E-15
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 642 925 3.0E-15
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 593 925 3.0E-15
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 642 925 3.0E-15
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 657 925 4.0E-15
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 643 925 4.0E-15
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 643 925 5.0E-15
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 643 925 5.0E-15
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 643 925 6.0E-15
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 642 925 7.0E-15
sp|Q93VK0|PPCK2_ARATH Phosphoenolpyruvate carboxylase kinase 2 OS=Arabidopsis thaliana GN=PPCK2 PE=1 SV=2 642 922 7.0E-15
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 641 925 8.0E-15
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 640 925 9.0E-15
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 642 925 1.0E-14
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 642 925 1.0E-14
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 642 925 1.0E-14
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 642 925 1.0E-14
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 642 925 1.0E-14
sp|Q12852|M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens GN=MAP3K12 PE=1 SV=2 643 866 1.0E-14
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 642 925 1.0E-14
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 632 930 1.0E-14
sp|Q63796|M3K12_RAT Mitogen-activated protein kinase kinase kinase 12 OS=Rattus norvegicus GN=Map3k12 PE=1 SV=1 643 866 1.0E-14
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 643 924 1.0E-14
sp|Q60700|M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus GN=Map3k12 PE=1 SV=1 643 866 2.0E-14
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 642 925 2.0E-14
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 642 925 2.0E-14
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 643 925 2.0E-14
sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis GN=map3k13-b PE=2 SV=1 639 866 2.0E-14
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 642 925 2.0E-14
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 643 925 2.0E-14
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 642 925 2.0E-14
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 642 925 2.0E-14
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 642 925 2.0E-14
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 628 924 3.0E-14
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 656 924 3.0E-14
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 674 947 3.0E-14
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 656 924 3.0E-14
sp|Q84SN3|CDKF3_ORYSJ Cyclin-dependent kinase F-3 OS=Oryza sativa subsp. japonica GN=CDKF-3 PE=2 SV=1 642 929 3.0E-14
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 642 929 3.0E-14
sp|O18209|PMY13_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis elegans GN=wee-1.3 PE=1 SV=1 643 932 3.0E-14
sp|Q1ZXH2|FHKB_DICDI Probable serine/threonine-protein kinase fhkB OS=Dictyostelium discoideum GN=fhkB PE=3 SV=1 642 925 3.0E-14
sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 642 925 3.0E-14
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 510 925 4.0E-14
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 680 924 4.0E-14
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 657 925 4.0E-14
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 643 925 4.0E-14
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 674 947 4.0E-14
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 657 925 4.0E-14
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 631 941 5.0E-14
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 688 925 5.0E-14
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 657 925 5.0E-14
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 643 925 5.0E-14
sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 642 925 5.0E-14
sp|A0JLX3|SMK4A_MOUSE Sperm motility kinase 4A OS=Mus musculus GN=Smok4a PE=2 SV=2 643 924 6.0E-14
sp|Q15139|KPCD1_HUMAN Serine/threonine-protein kinase D1 OS=Homo sapiens GN=PRKD1 PE=1 SV=2 634 925 6.0E-14
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 618 935 6.0E-14
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 688 925 6.0E-14
sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 642 925 6.0E-14
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 642 925 6.0E-14
sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 642 925 6.0E-14
sp|Q9WTQ1|KPCD1_RAT Serine/threonine-protein kinase D1 OS=Rattus norvegicus GN=Prkd1 PE=1 SV=2 634 925 6.0E-14
sp|Q62101|KPCD1_MOUSE Serine/threonine-protein kinase D1 OS=Mus musculus GN=Prkd1 PE=1 SV=2 634 925 6.0E-14
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 643 942 7.0E-14
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 651 927 8.0E-14
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 627 924 8.0E-14
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 653 925 9.0E-14
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 627 924 9.0E-14
sp|Q9DGA5|CDK1_ORYCU Cyclin-dependent kinase 1 OS=Oryzias curvinotus GN=cdk1 PE=2 SV=1 642 925 1.0E-13
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 680 931 1.0E-13
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 642 922 1.0E-13
sp|Q5RCH1|CDK1_PONAB Cyclin-dependent kinase 1 OS=Pongo abelii GN=CDK1 PE=2 SV=1 642 925 1.0E-13
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 642 895 1.0E-13
sp|Q75V57|SAPK9_ORYSJ Serine/threonine-protein kinase SAPK9 OS=Oryza sativa subsp. japonica GN=SAPK9 PE=2 SV=1 642 958 1.0E-13
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 642 922 1.0E-13
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 642 922 1.0E-13
sp|A7J1T2|M313A_XENLA Mitogen-activated protein kinase kinase kinase 13-A OS=Xenopus laevis GN=map3k13-a PE=2 SV=1 639 866 1.0E-13
sp|O94737|MAPK1_PNECA Mitogen-activated protein kinase 1 OS=Pneumocystis carinii GN=MKP1 PE=1 SV=1 643 925 1.0E-13
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 643 925 2.0E-13
sp|O43283|M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens GN=MAP3K13 PE=1 SV=1 635 866 2.0E-13
sp|P13863|CDK1_CHICK Cyclin-dependent kinase 1 OS=Gallus gallus GN=CDK1 PE=1 SV=1 642 925 2.0E-13
sp|P39951|CDK1_RAT Cyclin-dependent kinase 1 OS=Rattus norvegicus GN=Cdk1 PE=1 SV=1 642 925 2.0E-13
sp|A7MBB4|M3K13_BOVIN Mitogen-activated protein kinase kinase kinase 13 OS=Bos taurus GN=MAP3K13 PE=2 SV=1 635 866 2.0E-13
sp|P41808|SMK1_YEAST Sporulation-specific mitogen-activated protein kinase SMK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMK1 PE=1 SV=1 643 925 2.0E-13
sp|Q5R8X7|M3K13_PONAB Mitogen-activated protein kinase kinase kinase 13 OS=Pongo abelii GN=MAP3K13 PE=2 SV=1 635 866 2.0E-13
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 640 925 2.0E-13
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 640 925 2.0E-13
sp|Q1HKZ5|M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus GN=Map3k13 PE=1 SV=1 635 866 2.0E-13
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 640 925 2.0E-13
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 677 925 2.0E-13
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 674 947 2.0E-13
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 640 925 2.0E-13
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 640 925 2.0E-13
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 688 925 2.0E-13
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 643 925 2.0E-13
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 642 920 2.0E-13
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 643 930 2.0E-13
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 632 924 2.0E-13
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 688 925 3.0E-13
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 688 925 3.0E-13
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 642 925 3.0E-13
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 642 939 3.0E-13
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 642 930 3.0E-13
sp|A2KF29|SMKTR_MOUSE Sperm motility kinase Tcr mutant form OS=Mus musculus GN=Smoktcr PE=2 SV=1 643 924 3.0E-13
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 658 922 3.0E-13
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 627 933 3.0E-13
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 641 925 3.0E-13
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 643 925 4.0E-13
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 643 925 4.0E-13
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 688 920 4.0E-13
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 643 925 4.0E-13
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 642 925 4.0E-13
sp|Q80YP0|CDK3_MOUSE Cyclin-dependent kinase 3 OS=Mus musculus GN=Cdk3 PE=1 SV=2 642 927 4.0E-13
sp|P51136|GSK3_DICDI Glycogen synthase kinase-3 OS=Dictyostelium discoideum GN=gskA PE=1 SV=2 629 925 4.0E-13
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 643 925 5.0E-13
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 643 925 5.0E-13
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 627 924 5.0E-13
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 643 925 5.0E-13
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 643 926 5.0E-13
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 660 867 5.0E-13
sp|P48734|CDK1_BOVIN Cyclin-dependent kinase 1 OS=Bos taurus GN=CDK1 PE=2 SV=2 642 925 5.0E-13
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 643 925 5.0E-13
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 643 925 5.0E-13
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 636 867 5.0E-13
sp|Q21029|NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans GN=nsy-1 PE=1 SV=4 638 926 6.0E-13
sp|P00518|PHKG1_RABIT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus GN=PHKG1 PE=1 SV=2 654 936 6.0E-13
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 676 922 6.0E-13
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 642 925 6.0E-13
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 643 925 6.0E-13
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 643 925 7.0E-13
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 642 925 7.0E-13
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 643 925 7.0E-13
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 643 925 7.0E-13
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 652 925 7.0E-13
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 643 924 7.0E-13
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 643 924 7.0E-13
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 643 925 7.0E-13
sp|Q940H6|SRK2E_ARATH Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1 688 925 7.0E-13
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 680 924 8.0E-13
sp|P11440|CDK1_MOUSE Cyclin-dependent kinase 1 OS=Mus musculus GN=Cdk1 PE=1 SV=3 642 925 8.0E-13
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 676 925 8.0E-13
sp|Q54U31|SHKD_DICDI Dual specificity protein kinase shkD OS=Dictyostelium discoideum GN=shkD PE=3 SV=1 643 920 9.0E-13
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 651 927 9.0E-13
sp|P07934|PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus GN=Phkg1 PE=1 SV=3 654 936 9.0E-13
sp|Q54MY9|MKCA_DICDI Probable serine/threonine-protein kinase mkcA OS=Dictyostelium discoideum GN=mkcA PE=2 SV=1 677 925 9.0E-13
sp|Q07250|KCCS_MALDO Calcium/calmodulin-dependent serine/threonine-protein kinase OS=Malus domestica PE=2 SV=1 688 924 1.0E-12
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 687 925 1.0E-12
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 643 925 1.0E-12
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 623 927 1.0E-12
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 680 924 1.0E-12
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 642 925 1.0E-12
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 643 924 1.0E-12
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 636 925 1.0E-12
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 643 939 1.0E-12
sp|Q80Y86|MK15_MOUSE Mitogen-activated protein kinase 15 OS=Mus musculus GN=Mapk15 PE=1 SV=1 642 924 1.0E-12
sp|P87050|CDR2_SCHPO Mitosis inducer protein kinase cdr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr2 PE=1 SV=1 641 966 1.0E-12
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 642 925 1.0E-12
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 682 925 1.0E-12
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 632 925 1.0E-12
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 643 925 2.0E-12
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 643 959 2.0E-12
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 668 931 2.0E-12
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 642 925 2.0E-12
sp|Q9LX30|GCN2_ARATH Probable serine/threonine-protein kinase GCN2 OS=Arabidopsis thaliana GN=GCN2 PE=2 SV=2 643 938 2.0E-12
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 636 922 2.0E-12
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 643 924 2.0E-12
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 643 924 2.0E-12
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 642 925 2.0E-12
sp|B1H3E1|NLK2_XENTR Serine/threonine-protein kinase NLK2 OS=Xenopus tropicalis GN=nlk.2 PE=2 SV=1 658 925 2.0E-12
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 636 925 2.0E-12
sp|Q8L4H0|WEE1_ARATH Wee1-like protein kinase OS=Arabidopsis thaliana GN=WEE1 PE=1 SV=1 642 925 2.0E-12
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 660 953 2.0E-12
sp|Q6P431|MKNK2_XENLA MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus laevis GN=mknk2 PE=2 SV=1 677 924 2.0E-12
sp|P23573|CDK2_DROME Cyclin-dependent kinase 2 OS=Drosophila melanogaster GN=Cdk2 PE=1 SV=1 642 925 2.0E-12
sp|Q9ESG9|PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus GN=Pkmyt1 PE=2 SV=3 642 929 3.0E-12
sp|P13286|PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus GN=Phkg1 PE=2 SV=2 654 936 3.0E-12
sp|P97756|KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus GN=Camkk1 PE=1 SV=1 740 924 3.0E-12
sp|Q8QGV6|NLK2_XENLA Serine/threonine-protein kinase NLK2 OS=Xenopus laevis GN=nlk.2 PE=1 SV=1 658 925 3.0E-12
sp|P20794|MAK_HUMAN Serine/threonine-protein kinase MAK OS=Homo sapiens GN=MAK PE=1 SV=2 642 964 3.0E-12
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 643 925 3.0E-12
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 630 925 3.0E-12
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 664 925 3.0E-12
sp|Q15831|STK11_HUMAN Serine/threonine-protein kinase STK11 OS=Homo sapiens GN=STK11 PE=1 SV=1 675 925 3.0E-12
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 643 925 3.0E-12
sp|Q54F40|Y1133_DICDI Probable protein kinase DDB_G0291133 OS=Dictyostelium discoideum GN=DDB_G0291133 PE=3 SV=1 629 865 3.0E-12
sp|Q9GT24|ZYG1_CAEEL Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis elegans GN=zyg-1 PE=1 SV=1 642 926 3.0E-12
sp|Q15772|SPEG_HUMAN Striated muscle preferentially expressed protein kinase OS=Homo sapiens GN=SPEG PE=1 SV=4 656 925 3.0E-12
sp|A1CAF0|MPKC_ASPCL Mitogen-activated protein kinase mpkC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mpkC PE=3 SV=1 643 927 3.0E-12
sp|A2YNT8|SAPK2_ORYSI Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica GN=SAPK2 PE=2 SV=2 688 925 3.0E-12
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 688 925 3.0E-12
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 642 925 3.0E-12
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 643 924 4.0E-12
sp|P23572|CDK1_DROME Cyclin-dependent kinase 1 OS=Drosophila melanogaster GN=Cdk1 PE=1 SV=1 642 925 4.0E-12
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 660 924 4.0E-12
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 678 926 4.0E-12
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 642 944 4.0E-12
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 678 926 4.0E-12
sp|Q8BZ03|KPCD2_MOUSE Serine/threonine-protein kinase D2 OS=Mus musculus GN=Prkd2 PE=1 SV=1 634 925 4.0E-12
sp|Q0D4J7|SAPK2_ORYSJ Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica GN=SAPK2 PE=1 SV=1 688 925 4.0E-12
sp|Q7ZVS3|PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio GN=plk4 PE=2 SV=2 643 925 4.0E-12
sp|Q9BZL6|KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens GN=PRKD2 PE=1 SV=2 634 925 5.0E-12
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 660 924 5.0E-12
sp|Q5XIS9|KPCD2_RAT Serine/threonine-protein kinase D2 OS=Rattus norvegicus GN=Prkd2 PE=1 SV=1 634 925 5.0E-12
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 642 925 5.0E-12
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 688 942 5.0E-12
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 641 925 5.0E-12
sp|D3ZSZ3|NLK_RAT Serine/threonine-protein kinase NLK OS=Rattus norvegicus GN=Nlk PE=3 SV=1 658 925 5.0E-12
sp|O54949|NLK_MOUSE Serine/threonine-protein kinase NLK OS=Mus musculus GN=Nlk PE=1 SV=2 658 925 5.0E-12
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 735 924 5.0E-12
sp|Q9UBE8|NLK_HUMAN Serine/threonine-protein kinase NLK OS=Homo sapiens GN=NLK PE=1 SV=2 658 925 5.0E-12
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 642 944 5.0E-12
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 676 925 5.0E-12
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 688 942 5.0E-12
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 660 924 6.0E-12
sp|Q54I36|PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum GN=pyk3 PE=1 SV=1 636 938 6.0E-12
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 642 925 6.0E-12
sp|Q7Y0B9|SAPK8_ORYSJ Serine/threonine-protein kinase SAPK8 OS=Oryza sativa subsp. japonica GN=SAPK8 PE=2 SV=1 688 925 6.0E-12
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 676 925 6.0E-12
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 688 942 6.0E-12
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 533 924 6.0E-12
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 551 925 6.0E-12
sp|Q6Z437|MPK3_ORYSJ Mitogen-activated protein kinase 3 OS=Oryza sativa subsp. japonica GN=MPK3 PE=2 SV=1 643 927 6.0E-12
sp|Q6P3N6|CDK8_XENTR Cyclin-dependent kinase 8 OS=Xenopus tropicalis GN=cdk8 PE=2 SV=1 625 959 6.0E-12
sp|E1BMN8|NLK_BOVIN Serine/threonine-protein kinase NLK OS=Bos taurus GN=NLK PE=3 SV=2 658 925 6.0E-12
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 643 925 6.0E-12
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 643 925 6.0E-12
sp|E2QWQ2|NLK_CANLF Serine/threonine-protein kinase NLK OS=Canis lupus familiaris GN=NLK PE=3 SV=1 658 925 6.0E-12
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 688 942 6.0E-12
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 642 925 6.0E-12
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 688 925 7.0E-12
sp|O64812|SRK2J_ARATH Serine/threonine-protein kinase SRK2J OS=Arabidopsis thaliana GN=SRK2J PE=1 SV=1 643 925 7.0E-12
sp|P42525|ERK1_DICDI Extracellular signal-regulated kinase 1 OS=Dictyostelium discoideum GN=erkA PE=2 SV=2 643 956 7.0E-12
sp|Q07176|MMK1_MEDSA Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1 643 976 7.0E-12
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 643 925 7.0E-12
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 680 925 7.0E-12
sp|Q66I46|MKNK2_XENTR MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus tropicalis GN=mknk2 PE=2 SV=1 677 924 7.0E-12
sp|Q8JH47|CDK8_DANRE Cyclin-dependent kinase 8 OS=Danio rerio GN=cdk8 PE=2 SV=1 625 959 8.0E-12
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 642 846 8.0E-12
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 678 924 8.0E-12
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 678 924 8.0E-12
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 643 925 8.0E-12
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 642 925 9.0E-12
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 643 925 9.0E-12
sp|Q9Z2A6|MK15_RAT Mitogen-activated protein kinase 15 OS=Rattus norvegicus GN=Mapk15 PE=1 SV=2 642 924 9.0E-12
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 642 926 9.0E-12
sp|Q04859|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2 639 925 9.0E-12
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 642 921 9.0E-12
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 643 944 1.0E-11
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 636 930 1.0E-11
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 643 944 1.0E-11
sp|Q06060|MPK_PEA Mitogen-activated protein kinase homolog D5 OS=Pisum sativum PE=2 SV=1 643 976 1.0E-11
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 636 920 1.0E-11
sp|Q8VBY2|KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus GN=Camkk1 PE=1 SV=1 740 924 1.0E-11
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 678 922 1.0E-11
sp|Q8FUI4|PKN2_COREF Serine/threonine-protein kinases drp72 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0034 PE=3 SV=1 660 913 1.0E-11
sp|Q04770|CDK2_ENTHI Cell division protein kinase 2 homolog OS=Entamoeba histolytica GN=CDC2 PE=3 SV=1 642 930 1.0E-11
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 643 927 1.0E-11
sp|Q9BWU1|CDK19_HUMAN Cyclin-dependent kinase 19 OS=Homo sapiens GN=CDK19 PE=1 SV=1 641 868 1.0E-11
sp|Q8QHK8|MK08_XENLA Mitogen-activated protein kinase 8 OS=Xenopus laevis GN=mapk8 PE=2 SV=2 643 925 1.0E-11
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 643 925 1.0E-11
sp|Q10N20|MPK5_ORYSJ Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. japonica GN=MPK5 PE=1 SV=1 643 933 1.0E-11
sp|A2XFC8|MPK5_ORYSI Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. indica GN=MPK5 PE=1 SV=2 643 933 1.0E-11
sp|Q8BWD8|CDK19_MOUSE Cyclin-dependent kinase 19 OS=Mus musculus GN=Cdk19 PE=2 SV=1 641 868 1.0E-11
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 580 925 1.0E-11
sp|Q9LV37|MPK9_ARATH Mitogen-activated protein kinase 9 OS=Arabidopsis thaliana GN=MPK9 PE=2 SV=2 643 1024 1.0E-11
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 643 927 1.0E-11
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 635 930 1.0E-11
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 676 923 1.0E-11
sp|Q54XL6|FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum GN=fray1 PE=3 SV=1 643 930 1.0E-11
sp|A1DES4|MPKC_NEOFI Mitogen-activated protein kinase mpkC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mpkc PE=3 SV=2 643 927 1.0E-11
sp|Q39238|TSL_ARATH Serine/threonine-protein kinase TOUSLED OS=Arabidopsis thaliana GN=TOUSLED PE=1 SV=1 683 930 1.0E-11
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 680 924 1.0E-11
sp|Q99640|PMYT1_HUMAN Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens GN=PKMYT1 PE=1 SV=1 642 944 1.0E-11
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 643 925 1.0E-11
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 613 925 1.0E-11
sp|P0C5D6|SAPK3_ORYSJ Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1 688 925 1.0E-11
sp|A2ZAB5|SAPK3_ORYSI Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. indica GN=SAPK3 PE=1 SV=2 688 925 1.0E-11
sp|Q75KK8|MPK14_ORYSJ Mitogen-activated protein kinase 14 OS=Oryza sativa subsp. japonica GN=MPK14 PE=2 SV=1 640 986 2.0E-11
sp|Q62407|SPEG_MOUSE Striated muscle-specific serine/threonine-protein kinase OS=Mus musculus GN=Speg PE=1 SV=2 656 925 2.0E-11
sp|P20793|MAK_RAT Serine/threonine-protein kinase MAK OS=Rattus norvegicus GN=Mak PE=1 SV=2 639 925 2.0E-11
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 677 1039 2.0E-11
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 677 1039 2.0E-11
sp|Q6ZI44|SAPK6_ORYSJ Serine/threonine-protein kinase SAPK6 OS=Oryza sativa subsp. japonica GN=SAPK6 PE=2 SV=1 643 925 2.0E-11
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 642 820 2.0E-11
sp|Q63638|SPEG_RAT Striated muscle-specific serine/threonine-protein kinase OS=Rattus norvegicus GN=Speg PE=1 SV=2 656 925 2.0E-11
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 642 925 2.0E-11
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 643 925 2.0E-11
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 643 925 2.0E-11
sp|P9WI67|PKNJ_MYCTU Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknJ PE=1 SV=1 640 866 2.0E-11
sp|P9WI66|PKNJ_MYCTO Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknJ PE=1 SV=1 640 866 2.0E-11
sp|P65733|PKNJ_MYCBO Serine/threonine-protein kinase PknJ OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknJ PE=3 SV=1 640 866 2.0E-11
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 676 925 2.0E-11
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 642 925 2.0E-11
sp|Q9LQQ9|MPK13_ARATH Mitogen-activated protein kinase 13 OS=Arabidopsis thaliana GN=MPK13 PE=1 SV=1 622 925 2.0E-11
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 636 925 2.0E-11
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 676 925 2.0E-11
sp|Q8CDB0|MKNK2_MOUSE MAP kinase-interacting serine/threonine-protein kinase 2 OS=Mus musculus GN=Mknk2 PE=1 SV=3 643 924 2.0E-11
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 642 870 2.0E-11
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 643 925 2.0E-11
sp|Q84UI5|MPK1_ORYSJ Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1 643 961 2.0E-11
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 676 925 2.0E-11
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 735 925 2.0E-11
sp|Q9VT57|CDK8_DROME Cyclin-dependent kinase 8 OS=Drosophila melanogaster GN=Cdk8 PE=1 SV=2 641 868 2.0E-11
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 642 870 2.0E-11
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 643 924 2.0E-11
sp|Q5U2N4|MKNK2_RAT MAP kinase-interacting serine/threonine-protein kinase 2 OS=Rattus norvegicus GN=Mknk2 PE=2 SV=1 643 924 2.0E-11
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 621 941 2.0E-11
sp|Q7XKA8|SAPK5_ORYSJ Serine/threonine-protein kinase SAPK5 OS=Oryza sativa subsp. japonica GN=SAPK5 PE=2 SV=1 642 925 2.0E-11
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 642 870 2.0E-11
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 642 870 2.0E-11
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 687 929 2.0E-11
sp|Q15835|RK_HUMAN Rhodopsin kinase OS=Homo sapiens GN=GRK1 PE=1 SV=1 742 925 2.0E-11
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 642 921 3.0E-11
sp|Q8AYK6|WEE1A_XENLA Wee1-like protein kinase 1-A OS=Xenopus laevis GN=wee1-a PE=2 SV=1 642 922 3.0E-11
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 642 846 3.0E-11
sp|Q8N5S9|KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens GN=CAMKK1 PE=1 SV=2 740 924 3.0E-11
sp|Q39011|KSG7_ARATH Shaggy-related protein kinase eta OS=Arabidopsis thaliana GN=ASK7 PE=1 SV=2 634 833 3.0E-11
sp|Q90327|MK08A_CYPCA Mitogen-activated protein kinase 8A OS=Cyprinus carpio GN=mapk8a PE=2 SV=1 643 925 3.0E-11
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 625 925 3.0E-11
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 642 840 3.0E-11
sp|Q39026|MPK6_ARATH Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana GN=MPK6 PE=1 SV=1 643 943 3.0E-11
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 642 944 3.0E-11
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 676 925 3.0E-11
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 642 846 3.0E-11
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 643 922 3.0E-11
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 642 846 3.0E-11
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 642 944 3.0E-11
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 631 925 3.0E-11
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 642 846 3.0E-11
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 642 846 4.0E-11
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 642 925 4.0E-11
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 642 840 4.0E-11
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 642 925 4.0E-11
sp|Q54BF0|FHKA_DICDI Probable serine/threonine-protein kinase fhkA OS=Dictyostelium discoideum GN=fhkA PE=3 SV=1 642 925 4.0E-11
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 642 840 4.0E-11
sp|Q23915|KINX_DICDI Probable serine/threonine-protein kinase kinX OS=Dictyostelium discoideum GN=kinX PE=3 SV=2 642 919 4.0E-11
sp|Q7RM49|CDC2H_PLAYO Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1 642 925 4.0E-11
sp|Q6Z8C8|CDKF4_ORYSJ Cyclin-dependent kinase F-4 OS=Oryza sativa subsp. japonica GN=CDKF-4 PE=2 SV=1 642 925 4.0E-11
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 643 927 4.0E-11
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 640 925 4.0E-11
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 643 925 4.0E-11
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 643 927 4.0E-11
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 659 925 4.0E-11
sp|Q8R9T6|PKN1_CALS4 Probable serine/threonine-protein kinase Sps1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=sps1 PE=3 SV=1 660 948 4.0E-11
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 642 944 5.0E-11
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 643 925 5.0E-11
sp|Q9ZSA3|CDPKM_ARATH Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana GN=CPK22 PE=3 SV=2 678 925 5.0E-11
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 622 866 5.0E-11
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 642 840 5.0E-11
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 642 840 5.0E-11
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 642 840 5.0E-11
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 642 840 5.0E-11
sp|P70032|PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis GN=plk1 PE=1 SV=1 652 925 5.0E-11
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 642 840 5.0E-11
sp|O94806|KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens GN=PRKD3 PE=1 SV=1 634 925 5.0E-11
sp|P36005|KDX1_YEAST Serine/threonine-protein kinase KDX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KDX1 PE=1 SV=1 659 925 5.0E-11
sp|P04551|CDK1_SCHPO Cyclin-dependent kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc2 PE=1 SV=1 642 855 5.0E-11
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 643 927 5.0E-11
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 678 922 5.0E-11
sp|Q55GS4|CDK10_DICDI Probable cyclin-dependent kinase 10 OS=Dictyostelium discoideum GN=cdk10 PE=2 SV=1 643 926 5.0E-11
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 673 878 5.0E-11
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 642 840 5.0E-11
sp|Q9C958|SRK2B_ARATH Serine/threonine-protein kinase SRK2B OS=Arabidopsis thaliana GN=SRK2B PE=1 SV=1 688 925 5.0E-11
sp|Q8WQG9|JNK1_CAEEL Stress-activated protein kinase jnk-1 OS=Caenorhabditis elegans GN=jnk-1 PE=1 SV=2 582 924 5.0E-11
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 643 925 5.0E-11
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 642 840 5.0E-11
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 642 924 6.0E-11
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 643 925 6.0E-11
sp|Q84TI6|CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana GN=CDKE-1 PE=1 SV=2 636 925 6.0E-11
sp|Q00534|CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens GN=CDK6 PE=1 SV=1 642 925 6.0E-11
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 643 922 6.0E-11
sp|Q9UL54|TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens GN=TAOK2 PE=1 SV=2 642 924 6.0E-11
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 678 926 7.0E-11
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 678 926 7.0E-11
sp|Q8QGV2|WEE1B_XENLA Wee1-like protein kinase 1-B OS=Xenopus laevis GN=wee1-b PE=1 SV=1 642 922 7.0E-11
sp|Q5KQF5|CIPKM_ORYSJ CBL-interacting protein kinase 22 OS=Oryza sativa subsp. japonica GN=CIPK22 PE=2 SV=1 677 925 7.0E-11
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 643 913 7.0E-11
sp|Q9SPK4|PPCK1_ARATH Phosphoenolpyruvate carboxylase kinase 1 OS=Arabidopsis thaliana GN=PPCK1 PE=1 SV=1 677 924 7.0E-11
sp|Q40532|NTF4_TOBAC Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1 643 940 7.0E-11
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 642 815 7.0E-11
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 688 925 8.0E-11
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 643 925 8.0E-11
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 677 924 8.0E-11
sp|Q54E34|Y6398_DICDI Probable protein kinase DDB_G0291842 OS=Dictyostelium discoideum GN=DDB_G0291842 PE=3 SV=1 642 922 8.0E-11
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 642 925 8.0E-11
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 643 860 8.0E-11
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 735 925 9.0E-11
sp|Q75LR7|SAPK1_ORYSJ Serine/threonine-protein kinase SAPK1 OS=Oryza sativa subsp. japonica GN=SAPK1 PE=1 SV=1 685 925 9.0E-11
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 644 925 9.0E-11
sp|Q9FFP9|SRK2H_ARATH Serine/threonine-protein kinase SRK2H OS=Arabidopsis thaliana GN=SRK2H PE=1 SV=1 688 925 9.0E-11
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 659 932 9.0E-11
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 643 927 9.0E-11
sp|Q6ZQ29|TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus GN=Taok2 PE=1 SV=3 642 924 9.0E-11
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 735 925 9.0E-11
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 677 924 9.0E-11
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 643 924 9.0E-11
sp|P23293|BUR1_YEAST Serine/threonine-protein kinase BUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGV1 PE=1 SV=1 642 925 1.0E-10
sp|G5EE56|SRC1_CAEEL Tyrosine protein-kinase src-1 OS=Caenorhabditis elegans GN=src-1 PE=1 SV=1 636 866 1.0E-10
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 677 944 1.0E-10
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 676 922 1.0E-10
sp|Q9UV50|HOG1_DEBHA Mitogen-activated protein kinase HOG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HOG1 PE=1 SV=3 741 927 1.0E-10
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 643 925 1.0E-10
sp|Q9JLS3|TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus GN=Taok2 PE=1 SV=1 642 924 1.0E-10
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1 642 855 1.0E-10
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 643 932 1.0E-10
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 643 926 1.0E-10
sp|Q00772|SLT2_YEAST Mitogen-activated protein kinase SLT2/MPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLT2 PE=1 SV=2 642 925 1.0E-10
sp|P43291|SRK2A_ARATH Serine/threonine-protein kinase SRK2A OS=Arabidopsis thaliana GN=SRK2A PE=1 SV=1 688 925 1.0E-10
sp|Q17IE8|CDK8_AEDAE Cyclin-dependent kinase 8 OS=Aedes aegypti GN=Cdk8 PE=3 SV=2 641 868 1.0E-10
sp|Q8K1Y2|KPCD3_MOUSE Serine/threonine-protein kinase D3 OS=Mus musculus GN=Prkd3 PE=1 SV=1 643 925 1.0E-10
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 643 932 1.0E-10
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 644 925 1.0E-10
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 644 925 1.0E-10
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 643 925 1.0E-10
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 643 925 1.0E-10
sp|Q64261|CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus GN=Cdk6 PE=1 SV=2 642 925 1.0E-10
sp|Q55C57|GLKA_DICDI Probable serine/threonine-protein kinase glkA OS=Dictyostelium discoideum GN=glkA PE=3 SV=1 642 925 1.0E-10
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 681 935 1.0E-10
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 635 922 1.0E-10
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 514 924 1.0E-10
sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens GN=CAMKK2 PE=1 SV=2 677 924 1.0E-10
sp|Q39193|SRK2I_ARATH Serine/threonine-protein kinase SRK2I OS=Arabidopsis thaliana GN=SRK2I PE=1 SV=1 688 925 1.0E-10
sp|Q39192|SRK2D_ARATH Serine/threonine-protein kinase SRK2D OS=Arabidopsis thaliana GN=SRK2D PE=1 SV=1 688 925 1.0E-10
sp|Q38772|CDC2A_ANTMA Cell division control protein 2 homolog A OS=Antirrhinum majus GN=CDC2A PE=2 SV=2 642 855 1.0E-10
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 636 859 1.0E-10
sp|A8X775|DLK1_CAEBR Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis briggsae GN=dlk-1 PE=3 SV=1 643 860 1.0E-10
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 643 925 1.0E-10
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 642 814 1.0E-10
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 677 944 2.0E-10
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 641 925 2.0E-10
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 641 925 2.0E-10
sp|P27361|MK03_HUMAN Mitogen-activated protein kinase 3 OS=Homo sapiens GN=MAPK3 PE=1 SV=4 740 955 2.0E-10
sp|A8XWC4|DKF1_CAEBR Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis briggsae GN=dkf-1 PE=3 SV=2 636 922 2.0E-10
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 677 944 2.0E-10
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 681 935 2.0E-10
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 642 925 2.0E-10
sp|Q20347|MKK4_CAEEL MAP kinase kinase mkk-4 OS=Caenorhabditis elegans GN=mkk-4 PE=3 SV=3 643 840 2.0E-10
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 643 921 8.0E-10
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 643 925 2.0E-08
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 643 925 3.0E-08
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 643 871 9.0E-08
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 687 925 1.0E-07
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 643 871 1.0E-07
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 643 925 3.0E-07
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 687 871 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006397 mRNA processing Yes
GO:0004540 ribonuclease activity Yes
GO:0006468 protein phosphorylation Yes
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0032559 adenyl ribonucleotide binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016301 kinase activity No
GO:0016740 transferase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0006396 RNA processing No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043168 anion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0016070 RNA metabolic process No
GO:0004518 nuclease activity No
GO:0071704 organic substance metabolic process No
GO:0016071 mRNA metabolic process No
GO:0016787 hydrolase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0046483 heterocycle metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:1901265 nucleoside phosphate binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No
GO:0140098 catalytic activity, acting on RNA No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4409
MRAPSLLWLRLTSPQLARSLEDWEVEDFVLLATVDGDLYASDRRTGKERWHLEVDRPMVETVHHRANLSVLDDDY
SPVDHYIWAVEPNRDGGVYVWVPGPDARPRATGFTMKRLVEDLAPYAAEEPAVVYTGDKKTTMITLDAATGRVIK
WFGSTGSHINEPESCLRPNALSGGKNVEECSSTGTLTLGRTEYTVGIQRRDGRPIATLRYAEWSPNNYDNDLFRQ
YHVSLDSRYITGQHDGNIYAFDYGRTKTTAPVFSHKFSAPVVRVFDVCRHWDASAKGNQELVVLPQPTMPSQDES
VARMRRNSIFLNQTEGGSWYALSGRQYPLIVDAPLAQVTFPGWWDVVSASDSLSEAKLSKALVGTHSLDTMRNEA
SHQQQTLSQGAITDGSGAGEDADNDSGIPIVVVETGEPTIINKVKGLPQSAANSVVDFIKNPILFLLFFAALVYN
EKKLRRSYRRWRVSGSLRDSLVYLTSPPSSSSSSSADDKDGRVRARQVMQQPDGHNKSSTDDEDQEPATTQDLDS
SSRTQLSPDRQSDAGGSAEGRHEAGSATELPTVERKKKAHRGRRGGVKHRKGRAREASQSRDDEAGATTVEEAVN
NAKKLGDWPSLEPDVMTVANDMQAVTGPIIRMGNIEVNTEVQLGTGSNGTLVFAGRFDGREVAVKRMLIQFYDIA
SQETRLLRESDDHPNVIRYYSQQMRDGFLYIALERCAASLADVVERPQSYRELAEAGRIDVPGVLYQITNGISHL
HTLRIVHRDLKPQNILVNMGNDGRPRMLVSDFGLCKKLEGGQSSFGATTGRAAGTSGWRAPELLLDDDADMVSST
HSGSGTVLVSDAHGRRATRAIDIFSLGLVFFYVLTNGSHPFDCGDRYMREVNIRKGSHNLRPLDSLGDVAHEARD
LIASMLAADAKLRPSTRDIMSHPFFWPPKKRLSFLCDVSDHFEKEPRDPQSGPLSILEQHASLVTRGDFLRLLPR
EFVDSLGKQRRYSPDRFLDLLRALRNKRNHYEDMSEPLRRMVGPLPDGYLGFWTVRFPHLLLVCWKVVHEVKWHE
SDRFREYYKPAGL*
Coding >Ophun1|4409
ATGCGAGCGCCCTCGCTACTTTGGCTCCGGCTCACCTCGCCGCAGCTTGCGCGGAGTCTGGAGGACTGGGAAGTA
GAAGACTTTGTTCTTCTGGCGACCGTCGATGGAGACCTCTACGCCAGCGATCGCAGGACCGGCAAGGAGCGCTGG
CACCTCGAGGTGGACCGGCCCATGGTCGAGACGGTCCACCACCGTGCCAACCTCTCGGTCCTCGACGACGACTAC
AGCCCCGTCGACCACTACATCTGGGCCGTCGAGCCCAATCGCGACGGCGGCGTCTACGTCTGGGTCCCCGGCCCG
GATGCCCGCCCGCGCGCCACGGGCTTCACAATGAAGCGCCTGGTCGAGGACCTGGCCCCTTACGCAGCCGAGGAG
CCGGCCGTCGTCTACACGGGCGACAAGAAGACGACCATGATTACGCTCGACGCCGCCACCGGCCGCGTCATCAAG
TGGTTCGGCTCCACCGGCTCCCACATCAACGAACCCGAGAGCTGTCTGCGGCCCAATGCCCTCTCGGGCGGAAAG
AATGTCGAGGAGTGCAGCTCGACGGGGACGCTGACCCTCGGACGGACCGAGTACACGGTAGGCATCCAGCGACGC
GACGGTCGGCCAATTGCCACGCTCCGATACGCCGAATGGAGCCCCAACAACTACGACAACGATCTGTTCCGGCAG
TACCACGTCTCGCTCGACAGTCGCTACATCACGGGCCAGCACGACGGCAACATATACGCCTTTGACTACGGTCGG
ACGAAGACGACGGCGCCCGTCTTTAGCCACAAGTTCTCGGCGCCCGTGGTGCGCGTCTTTGATGTATGCCGCCAC
TGGGATGCGTCGGCAAAGGGCAACCAGGAGCTGGTGGTGCTGCCGCAGCCGACGATGCCGTCACAGGACGAGAGC
GTGGCTCGCATGCGACGCAACAGCATCTTTCTCAACCAGACCGAGGGCGGCAGCTGGTACGCGCTGTCGGGACGG
CAGTATCCTCTCATCGTCGACGCTCCCCTGGCCCAGGTAACGTTTCCCGGCTGGTGGGACGTGGTGTCGGCCTCG
GACAGCCTCAGCGAGGCGAAGCTATCCAAGGCCCTCGTCGGCACCCACTCGCTCGACACGATGCGCAACGAGGCC
TCGCACCAGCAGCAGACTCTGTCCCAAGGGGCCATCACAGACGGCTCCGGCGCCGGCGAAGATGCGGACAACGAC
TCGGGCATCCCCATCGTCGTCGTCGAGACGGGCGAGCCGACCATCATCAACAAGGTCAAGGGTCTGCCGCAGAGC
GCGGCCAACAGCGTGGTGGACTTCATTAAGAACCCGATCTTGTTCCTCCTCTTTTTCGCCGCTCTCGTCTACAAC
GAGAAGAAACTGCGGAGGTCATATCGCCGGTGGCGTGTGAGCGGTAGCTTGCGGGACTCTCTGGTCTACCTGACG
TCGCCGCCGTCGTCCTCGTCTTCGTCGTCGGCAGACGACAAGGATGGCCGGGTGCGAGCCCGACAAGTGATGCAG
CAGCCGGACGGTCATAACAAGTCATCGACGGACGACGAGGACCAAGAGCCGGCGACGACGCAGGATCTGGATAGC
TCCAGCAGGACGCAATTATCGCCCGACAGACAGTCGGACGCTGGGGGTTCGGCCGAGGGCCGGCACGAGGCGGGC
AGCGCCACGGAGCTCCCAACAGTGGAGAGAAAGAAGAAGGCGCATCGCGGCAGACGGGGCGGCGTTAAGCACCGC
AAAGGTCGGGCGCGAGAGGCGTCGCAATCTCGAGACGACGAGGCTGGGGCGACGACGGTGGAGGAGGCCGTCAAT
AACGCCAAGAAGCTGGGCGACTGGCCGAGCCTGGAGCCTGACGTGATGACGGTGGCCAACGACATGCAGGCGGTG
ACGGGGCCCATTATCCGGATGGGCAATATTGAGGTCAACACCGAGGTGCAGCTGGGGACCGGCAGCAACGGGACT
CTGGTGTTTGCGGGCCGGTTCGACGGACGCGAGGTGGCCGTGAAGCGGATGCTGATACAGTTTTATGATATTGCG
TCGCAGGAGACGCGGCTGTTGAGGGAGAGCGACGACCATCCGAACGTGATCCGGTACTACTCGCAGCAGATGCGT
GACGGTTTCCTCTACATTGCGCTGGAACGGTGCGCGGCTTCGCTGGCCGACGTGGTGGAGCGGCCACAATCCTAT
CGCGAGTTGGCCGAGGCCGGACGCATCGACGTGCCCGGGGTGTTATATCAGATCACCAACGGCATCAGTCACCTT
CACACCCTGCGGATCGTGCACCGCGACCTCAAGCCGCAGAATATCCTGGTCAATATGGGCAACGACGGGCGGCCG
CGAATGCTCGTGTCGGACTTTGGCCTCTGCAAGAAGCTCGAGGGCGGCCAGTCGTCGTTTGGGGCCACGACAGGA
CGGGCAGCTGGTACATCAGGCTGGCGAGCGCCGGAGCTGCTACTCGACGACGACGCCGACATGGTGAGCTCTACG
CATAGCGGCTCCGGGACGGTGCTGGTGAGCGACGCTCACGGGCGACGGGCCACGCGTGCCATCGACATCTTCTCG
CTCGGGCTCGTCTTCTTCTACGTTCTGACCAACGGGTCTCACCCCTTTGACTGCGGCGACCGTTACATGCGAGAG
GTCAACATCCGCAAGGGCAGCCACAACCTGCGTCCTCTCGACTCGCTCGGCGACGTTGCCCACGAGGCGCGCGAC
CTGATTGCCTCGATGTTGGCGGCCGACGCTAAGCTCCGACCGTCGACGCGCGACATCATGTCCCATCCCTTCTTC
TGGCCGCCCAAGAAGCGCCTATCCTTCCTCTGTGACGTCTCGGACCATTTCGAAAAGGAGCCTCGCGATCCGCAA
TCGGGACCGCTGTCAATTCTCGAACAGCACGCCTCGCTAGTAACACGGGGCGACTTCCTCCGCCTCCTCCCGCGG
GAATTTGTCGACTCCCTCGGCAAGCAACGCCGGTACTCACCAGACCGCTTCCTCGATCTTCTCCGCGCCCTGCGC
AACAAGCGTAACCACTACGAAGACATGAGCGAGCCTCTCCGCCGGATGGTTGGACCGTTACCAGACGGCTACCTT
GGCTTCTGGACGGTGCGGTTCCCGCACCTGCTTCTGGTTTGTTGGAAAGTGGTTCATGAGGTTAAGTGGCATGAG
TCGGATCGGTTTAGGGAGTATTATAAGCCTGCGGGGTTGTGA
Transcript >Ophun1|4409
ATGCGAGCGCCCTCGCTACTTTGGCTCCGGCTCACCTCGCCGCAGCTTGCGCGGAGTCTGGAGGACTGGGAAGTA
GAAGACTTTGTTCTTCTGGCGACCGTCGATGGAGACCTCTACGCCAGCGATCGCAGGACCGGCAAGGAGCGCTGG
CACCTCGAGGTGGACCGGCCCATGGTCGAGACGGTCCACCACCGTGCCAACCTCTCGGTCCTCGACGACGACTAC
AGCCCCGTCGACCACTACATCTGGGCCGTCGAGCCCAATCGCGACGGCGGCGTCTACGTCTGGGTCCCCGGCCCG
GATGCCCGCCCGCGCGCCACGGGCTTCACAATGAAGCGCCTGGTCGAGGACCTGGCCCCTTACGCAGCCGAGGAG
CCGGCCGTCGTCTACACGGGCGACAAGAAGACGACCATGATTACGCTCGACGCCGCCACCGGCCGCGTCATCAAG
TGGTTCGGCTCCACCGGCTCCCACATCAACGAACCCGAGAGCTGTCTGCGGCCCAATGCCCTCTCGGGCGGAAAG
AATGTCGAGGAGTGCAGCTCGACGGGGACGCTGACCCTCGGACGGACCGAGTACACGGTAGGCATCCAGCGACGC
GACGGTCGGCCAATTGCCACGCTCCGATACGCCGAATGGAGCCCCAACAACTACGACAACGATCTGTTCCGGCAG
TACCACGTCTCGCTCGACAGTCGCTACATCACGGGCCAGCACGACGGCAACATATACGCCTTTGACTACGGTCGG
ACGAAGACGACGGCGCCCGTCTTTAGCCACAAGTTCTCGGCGCCCGTGGTGCGCGTCTTTGATGTATGCCGCCAC
TGGGATGCGTCGGCAAAGGGCAACCAGGAGCTGGTGGTGCTGCCGCAGCCGACGATGCCGTCACAGGACGAGAGC
GTGGCTCGCATGCGACGCAACAGCATCTTTCTCAACCAGACCGAGGGCGGCAGCTGGTACGCGCTGTCGGGACGG
CAGTATCCTCTCATCGTCGACGCTCCCCTGGCCCAGGTAACGTTTCCCGGCTGGTGGGACGTGGTGTCGGCCTCG
GACAGCCTCAGCGAGGCGAAGCTATCCAAGGCCCTCGTCGGCACCCACTCGCTCGACACGATGCGCAACGAGGCC
TCGCACCAGCAGCAGACTCTGTCCCAAGGGGCCATCACAGACGGCTCCGGCGCCGGCGAAGATGCGGACAACGAC
TCGGGCATCCCCATCGTCGTCGTCGAGACGGGCGAGCCGACCATCATCAACAAGGTCAAGGGTCTGCCGCAGAGC
GCGGCCAACAGCGTGGTGGACTTCATTAAGAACCCGATCTTGTTCCTCCTCTTTTTCGCCGCTCTCGTCTACAAC
GAGAAGAAACTGCGGAGGTCATATCGCCGGTGGCGTGTGAGCGGTAGCTTGCGGGACTCTCTGGTCTACCTGACG
TCGCCGCCGTCGTCCTCGTCTTCGTCGTCGGCAGACGACAAGGATGGCCGGGTGCGAGCCCGACAAGTGATGCAG
CAGCCGGACGGTCATAACAAGTCATCGACGGACGACGAGGACCAAGAGCCGGCGACGACGCAGGATCTGGATAGC
TCCAGCAGGACGCAATTATCGCCCGACAGACAGTCGGACGCTGGGGGTTCGGCCGAGGGCCGGCACGAGGCGGGC
AGCGCCACGGAGCTCCCAACAGTGGAGAGAAAGAAGAAGGCGCATCGCGGCAGACGGGGCGGCGTTAAGCACCGC
AAAGGTCGGGCGCGAGAGGCGTCGCAATCTCGAGACGACGAGGCTGGGGCGACGACGGTGGAGGAGGCCGTCAAT
AACGCCAAGAAGCTGGGCGACTGGCCGAGCCTGGAGCCTGACGTGATGACGGTGGCCAACGACATGCAGGCGGTG
ACGGGGCCCATTATCCGGATGGGCAATATTGAGGTCAACACCGAGGTGCAGCTGGGGACCGGCAGCAACGGGACT
CTGGTGTTTGCGGGCCGGTTCGACGGACGCGAGGTGGCCGTGAAGCGGATGCTGATACAGTTTTATGATATTGCG
TCGCAGGAGACGCGGCTGTTGAGGGAGAGCGACGACCATCCGAACGTGATCCGGTACTACTCGCAGCAGATGCGT
GACGGTTTCCTCTACATTGCGCTGGAACGGTGCGCGGCTTCGCTGGCCGACGTGGTGGAGCGGCCACAATCCTAT
CGCGAGTTGGCCGAGGCCGGACGCATCGACGTGCCCGGGGTGTTATATCAGATCACCAACGGCATCAGTCACCTT
CACACCCTGCGGATCGTGCACCGCGACCTCAAGCCGCAGAATATCCTGGTCAATATGGGCAACGACGGGCGGCCG
CGAATGCTCGTGTCGGACTTTGGCCTCTGCAAGAAGCTCGAGGGCGGCCAGTCGTCGTTTGGGGCCACGACAGGA
CGGGCAGCTGGTACATCAGGCTGGCGAGCGCCGGAGCTGCTACTCGACGACGACGCCGACATGGTGAGCTCTACG
CATAGCGGCTCCGGGACGGTGCTGGTGAGCGACGCTCACGGGCGACGGGCCACGCGTGCCATCGACATCTTCTCG
CTCGGGCTCGTCTTCTTCTACGTTCTGACCAACGGGTCTCACCCCTTTGACTGCGGCGACCGTTACATGCGAGAG
GTCAACATCCGCAAGGGCAGCCACAACCTGCGTCCTCTCGACTCGCTCGGCGACGTTGCCCACGAGGCGCGCGAC
CTGATTGCCTCGATGTTGGCGGCCGACGCTAAGCTCCGACCGTCGACGCGCGACATCATGTCCCATCCCTTCTTC
TGGCCGCCCAAGAAGCGCCTATCCTTCCTCTGTGACGTCTCGGACCATTTCGAAAAGGAGCCTCGCGATCCGCAA
TCGGGACCGCTGTCAATTCTCGAACAGCACGCCTCGCTAGTAACACGGGGCGACTTCCTCCGCCTCCTCCCGCGG
GAATTTGTCGACTCCCTCGGCAAGCAACGCCGGTACTCACCAGACCGCTTCCTCGATCTTCTCCGCGCCCTGCGC
AACAAGCGTAACCACTACGAAGACATGAGCGAGCCTCTCCGCCGGATGGTTGGACCGTTACCAGACGGCTACCTT
GGCTTCTGGACGGTGCGGTTCCCGCACCTGCTTCTGGTTTGTTGGAAAGTGGTTCATGAGGTTAAGTGGCATGAG
TCGGATCGGTTTAGGGAGTATTATAAGCCTGCGGGGTTGTGA
Gene >Ophun1|4409
ATGCGAGCGCCCTCGCTACTTTGGCTCCGGCTCAGTCCGTCCGAGCACCACATCCTCCACGACATCAACGGCCCA
GCAGCGTGCCCGCTTCTGGCCTAGCCTCGCCGCAGCTTGCGCGGAGTCTGGAGGACTGGGAAGTAGAAGACTTTG
TTCTTCTGGCGACCGTCGATGGAGACCTCTACGCCAGCGATCGCAGGACCGGCAAGGAGCGCTGGCACCTCGAGG
TGGACCGGCCCATGGTCGAGACGGTCCACCACCGTGCCAACCTCTCGGTCCTCGACGACGACTACAGCCCCGTCG
ACCACTACATCTGGGCCGTCGAGCCCAATCGCGACGGCGGCGTCTACGTCTGGGTCCCCGGCCCGGATGCCCGCC
CGCGCGCCACGGGCTTCACAATGAAGCGCCTGGTCGAGGACCTGGCCCCTTACGCAGCCGAGGAGCCGGCCGTCG
TCTACACGGGCGACAAGAAGACGACCATGATTACGCTCGACGCCGCCACCGGCCGCGTCATCAAGTGGTTCGGCT
CCACCGGCTCCCACATCAACGAACCCGAGAGCTGTCTGCGGCCCAATGCCCTCTCGGGCGGAAAGAATGTCGAGG
AGTGCAGCTCGACGGGGACGCTGACCCTCGGACGGACCGAGTACACGGTAGGCATCCAGCGACGCGACGGTCGGC
CAATTGCCACGCTCCGATACGCCGAATGGAGCCCCAACAACTACGACAACGATCTGTTCCGGCAGTACCACGTCT
CGCTCGACAGTCGCTACATCACGGGCCAGCACGACGGCAACATATACGCCTTTGACTACGGTCGGACGAAGACGA
CGGCGCCCGTCTTTAGCCACAAGTTCTCGGCGCCCGTGGTGCGCGTCTTTGATGTATGCCGCCACTGGGATGCGT
CGGCAAAGGGCAACCAGGAGCTGGTGGTGCTGCCGCAGCCGACGATGCCGTCACAGGACGAGAGCGTGGCTCGCA
TGCGACGCAACAGCATCTTTCTCAACCAGACCGAGGGCGGCAGCTGGTACGCGCTGTCGGGACGGCAGTATCCTC
TCATCGTCGACGCTCCCCTGGCCCAGGTAACGTTTCCCGGCTGGTGGGACGTGGTGTCGGCCTCGGACAGCCTCA
GCGAGGCGAAGCTATCCAAGGCCCTCGTCGGCACCCACTCGCTCGACACGATGCGCAACGAGGCCTCGCACCAGC
AGCAGACTCTGTCCCAAGGGGCCATCACAGACGGCTCCGGCGCCGGCGAAGATGCGGACAACGACTCGGGCATCC
CCATCGTCGTCGTCGAGACGGGCGAGCCGACCATCATCAACAAGGTCAAGGGTCTGCCGCAGAGCGCGGCCAACA
GCGTGGTGGACTTCATTAAGAACCCGATCTTGTTCCTCCTCTTTTTCGCCGCTCTCGTCTACAACGAGAAGAAAC
TGCGGAGGTCATATCGCCGGTGGCGTGTGAGCGGTAGCTTGCGGGACTCTCTGGTCTACCTGACGTCGCCGCCGT
CGTCCTCGTCTTCGTCGTCGGCAGACGACAAGGATGGCCGGGTGCGAGCCCGACAAGTGATGCAGCAGCCGGACG
GTCATAACAAGTCATCGACGGACGACGAGGACCAAGAGCCGGCGACGACGCAGGATCTGGATAGCTCCAGCAGGA
CGCAATTATCGCCCGACAGACAGTCGGACGCTGGGGGTTCGGCCGAGGGCCGGCACGAGGCGGGCAGCGCCACGG
AGCTCCCAACAGTGGAGAGAAAGAAGAAGGCGCATCGCGGCAGACGGGGCGGCGTTAAGCACCGCAAAGGTCGGG
CGCGAGAGGCGTCGCAATCTCGAGACGACGAGGCTGGGGCGACGACGGTGGAGGAGGCCGTCAATAACGCCAAGA
AGCTGGGCGACTGGCCGAGCCTGGAGCCTGACGTGATGACGGTGGCCAACGACATGCAGGCGGTGACGGGGCCCA
TTATCCGGATGGGCAATATTGAGGTCAACACCGAGGTGCAGCTGGGGACCGGCAGCAACGGGACTCTGGTGTTTG
CGGGCCGGTTCGACGGACGCGAGGTGGCCGTGAAGCGGATGCTGATACAGTTTTATGATATTGCGTCGCAGGAGA
CGCGGCTGTTGAGGGAGAGCGACGACCATCCGAACGGTGGGTTCCCAGGCTGCCTCTGGTTCAGTGTCTGACGAT
GGCTGACGGTTGGCAGTGATCCGGTACTACTCGCAGCAGATGCGTGACGGTTTCCTCTACATTGCGCTGGAACGG
TGCGCGGCTTCGCTGGCCGACGTGGTGGAGCGGCCACAATCCTATCGCGAGTTGGCCGAGGCCGGACGCATCGAC
GTGCCCGGGGTGTTATATCAGATCACCAACGGCATCAGTCACCTTCACACCCTGCGGATCGTGCACCGCGACCTC
AAGCCGCAGAATATCCTGGTCAATATGGGCAACGACGGGCGGCCGCGAATGCTCGTGTCGGACTTTGGCCTCTGC
AAGAAGCTCGAGGGCGGCCAGTCGTCGTTTGGGGCCACGACAGGACGGGCAGCTGGTACATCAGGCTGGCGAGCG
CCGGAGCTGCTACTCGACGACGACGCCGACATGGTGAGCTCTACGCATAGCGGCTCCGGGACGGTGCTGGTGAGC
GACGCTCACGGGCGACGGGCCACGCGTGCCATCGACATCTTCTCGCTCGGGCTCGTCTTCTTCTACGTTCTGACC
AACGGGTCTCACCCCTTTGACTGCGGCGACCGTTACATGCGAGAGGTCAACATCCGCAAGGGCAGCCACAACCTG
CGTCCTCTCGACTCGCTCGGCGACGTTGCCCACGAGGCGCGCGACCTGATTGCCTCGATGTTGGCGGCCGACGCT
AAGCTCCGACCGTCGACGCGCGACATCATGTCCCATCCCTTCTTCTGGCCGCCCAAGAAGCGCCTATCCTTCCTC
TGTGACGTCTCGGACCATTTCGAAAAGGAGCCTCGCGATCCGCAATCGGGACCGCTGTCAATTCTCGAACAGCAC
GCCTCGCTAGTAACACGGGGCGACTTCCTCCGCCTCCTCCCGCGGGAATTTGTCGACTCCCTCGGCAAGCAACGC
CGGTACTCACCAGACCGCTTCCTCGATCTTCTCCGCGCCCTGCGCAACAAGCGTAACCACTACGAAGACATGAGC
GAGCCTCTCCGCCGGATGGTTGGACCGTTACCAGACGGCTACCTTGGCTTCTGGACGGTGCGGTTCCCGCACCTG
CTTCTGGTTTGTTGGAAAGTGGTTCATGAGGTTAAGTGGCATGAGTCGGATCGGTTTAGGGAGTATTATAAGCCT
GCGGGGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail