Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4404
Gene name
LocationContig_405:8201..10830
Strand+
Gene length (bp)2629
Transcript length (bp)2502
Coding sequence length (bp)2502
Protein length (aa) 834

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19277 GPAT_C Glycerol-3-phosphate acyltransferase C-terminal region 1.5E-160 344 761
PF01553 Acyltransferase Acyltransferase 5.4E-17 200 332

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O15228|GNPAT_HUMAN Dihydroxyacetone phosphate acyltransferase OS=Homo sapiens GN=GNPAT PE=1 SV=1 117 702 5.0E-48
sp|A4IF87|GNPAT_BOVIN Dihydroxyacetone phosphate acyltransferase OS=Bos taurus GN=GNPAT PE=2 SV=1 145 706 1.0E-45
sp|Q1I610|PLSB_PSEE4 Glycerol-3-phosphate acyltransferase OS=Pseudomonas entomophila (strain L48) GN=plsB PE=3 SV=1 209 607 6.0E-44
sp|Q9CLN7|PLSB_PASMU Glycerol-3-phosphate acyltransferase OS=Pasteurella multocida (strain Pm70) GN=plsB PE=3 SV=1 135 540 6.0E-44
sp|P44857|PLSB_HAEIN Glycerol-3-phosphate acyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=plsB PE=3 SV=1 114 540 8.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O15228|GNPAT_HUMAN Dihydroxyacetone phosphate acyltransferase OS=Homo sapiens GN=GNPAT PE=1 SV=1 117 702 5.0E-48
sp|A4IF87|GNPAT_BOVIN Dihydroxyacetone phosphate acyltransferase OS=Bos taurus GN=GNPAT PE=2 SV=1 145 706 1.0E-45
sp|Q1I610|PLSB_PSEE4 Glycerol-3-phosphate acyltransferase OS=Pseudomonas entomophila (strain L48) GN=plsB PE=3 SV=1 209 607 6.0E-44
sp|Q9CLN7|PLSB_PASMU Glycerol-3-phosphate acyltransferase OS=Pasteurella multocida (strain Pm70) GN=plsB PE=3 SV=1 135 540 6.0E-44
sp|P44857|PLSB_HAEIN Glycerol-3-phosphate acyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=plsB PE=3 SV=1 114 540 8.0E-44
sp|Q15MZ1|PLSB_PSEA6 Glycerol-3-phosphate acyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=plsB PE=3 SV=1 145 546 2.0E-43
sp|A1SBC6|PLSB_SHEAM Glycerol-3-phosphate acyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=plsB PE=3 SV=1 92 605 2.0E-43
sp|A5UDX7|PLSB_HAEIE Glycerol-3-phosphate acyltransferase OS=Haemophilus influenzae (strain PittEE) GN=plsB PE=3 SV=1 114 540 2.0E-43
sp|A5UHQ2|PLSB_HAEIG Glycerol-3-phosphate acyltransferase OS=Haemophilus influenzae (strain PittGG) GN=plsB PE=3 SV=1 114 540 2.0E-43
sp|Q4QMF0|PLSB_HAEI8 Glycerol-3-phosphate acyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=plsB PE=3 SV=1 114 540 2.0E-43
sp|P98192|GNPAT_MOUSE Dihydroxyacetone phosphate acyltransferase OS=Mus musculus GN=Gnpat PE=1 SV=1 129 706 3.0E-43
sp|B4S1W8|PLSB_ALTMD Glycerol-3-phosphate acyltransferase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=plsB PE=3 SV=1 135 546 3.0E-43
sp|Q3KHC9|PLSB_PSEPF Glycerol-3-phosphate acyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=plsB PE=3 SV=1 209 607 5.0E-43
sp|Q886Q7|PLSB_PSESM Glycerol-3-phosphate acyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=plsB PE=3 SV=1 63 608 5.0E-43
sp|Q88MQ0|PLSB_PSEPK Glycerol-3-phosphate acyltransferase OS=Pseudomonas putida (strain KT2440) GN=plsB PE=3 SV=1 209 607 5.0E-43
sp|B1JBS6|PLSB_PSEPW Glycerol-3-phosphate acyltransferase OS=Pseudomonas putida (strain W619) GN=plsB PE=3 SV=1 209 607 5.0E-43
sp|A4XWX9|PLSB_PSEMY Glycerol-3-phosphate acyltransferase OS=Pseudomonas mendocina (strain ymp) GN=plsB PE=3 SV=1 182 540 1.0E-42
sp|A5W867|PLSB_PSEP1 Glycerol-3-phosphate acyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=plsB PE=3 SV=1 209 607 2.0E-42
sp|B4EYR5|PLSB_PROMH Glycerol-3-phosphate acyltransferase OS=Proteus mirabilis (strain HI4320) GN=plsB PE=3 SV=1 182 549 2.0E-42
sp|B0KS79|PLSB_PSEPG Glycerol-3-phosphate acyltransferase OS=Pseudomonas putida (strain GB-1) GN=plsB PE=3 SV=1 209 607 2.0E-42
sp|A3QIU8|PLSB_SHELP Glycerol-3-phosphate acyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=plsB PE=3 SV=1 97 617 2.0E-42
sp|Q61586|GPAT1_MOUSE Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Mus musculus GN=Gpam PE=1 SV=2 89 554 3.0E-42
sp|F1S5L4|GPAT1_PIG Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Sus scrofa GN=GPAM PE=2 SV=3 202 554 3.0E-42
sp|Q4KHJ1|PLSB_PSEF5 Glycerol-3-phosphate acyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=plsB PE=3 SV=1 209 607 4.0E-42
sp|A6VQ68|PLSB_ACTSZ Glycerol-3-phosphate acyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=plsB PE=3 SV=1 149 540 4.0E-42
sp|Q9ES71|GNPAT_RAT Dihydroxyacetone phosphate acyltransferase OS=Rattus norvegicus GN=Gnpat PE=1 SV=1 129 706 7.0E-42
sp|Q12ID7|PLSB_SHEDO Glycerol-3-phosphate acyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=plsB PE=3 SV=1 92 602 9.0E-42
sp|Q4ZWU3|PLSB_PSEU2 Glycerol-3-phosphate acyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=plsB PE=3 SV=1 63 608 1.0E-41
sp|B8F321|PLSB_HAEPS Glycerol-3-phosphate acyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=plsB PE=3 SV=1 138 540 2.0E-41
sp|Q9HCL2|GPAT1_HUMAN Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Homo sapiens GN=GPAM PE=1 SV=3 202 554 2.0E-41
sp|A6TGV0|PLSB_KLEP7 Glycerol-3-phosphate acyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=plsB PE=3 SV=1 182 637 3.0E-41
sp|B7LL13|PLSB_ESCF3 Glycerol-3-phosphate acyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=plsB PE=3 SV=1 182 549 3.0E-41
sp|A6V1B5|PLSB_PSEA7 Glycerol-3-phosphate acyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=plsB PE=3 SV=1 63 540 3.0E-41
sp|Q5GJ77|GPAT1_BOVIN Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Bos taurus GN=GPAM PE=2 SV=1 197 566 3.0E-41
sp|Q9HXW7|PLSB_PSEAE Glycerol-3-phosphate acyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=plsB PE=3 SV=1 63 540 5.0E-41
sp|B7V2U0|PLSB_PSEA8 Glycerol-3-phosphate acyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=plsB PE=3 SV=1 63 540 5.0E-41
sp|C3K4R1|PLSB_PSEFS Glycerol-3-phosphate acyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=plsB PE=3 SV=1 209 561 7.0E-41
sp|P97564|GPAT1_RAT Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Rattus norvegicus GN=Gpam PE=1 SV=3 135 544 8.0E-41
sp|Q9PEJ7|PLSB_XYLFA Glycerol-3-phosphate acyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=plsB PE=3 SV=1 209 543 1.0E-40
sp|B0U229|PLSB_XYLFM Glycerol-3-phosphate acyltransferase OS=Xylella fastidiosa (strain M12) GN=plsB PE=3 SV=1 209 543 1.0E-40
sp|Q02RE5|PLSB_PSEAB Glycerol-3-phosphate acyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=plsB PE=3 SV=1 63 540 1.0E-40
sp|B0TNU4|PLSB_SHEHH Glycerol-3-phosphate acyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=plsB PE=3 SV=1 97 550 2.0E-40
sp|Q48F46|PLSB_PSE14 Glycerol-3-phosphate acyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=plsB PE=3 SV=1 63 540 2.0E-40
sp|Q87KN0|PLSB_VIBPA Glycerol-3-phosphate acyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=plsB PE=3 SV=1 116 540 2.0E-40
sp|B5XXZ1|PLSB_KLEP3 Glycerol-3-phosphate acyltransferase OS=Klebsiella pneumoniae (strain 342) GN=plsB PE=3 SV=1 182 540 2.0E-40
sp|Q7UBC6|PLSB_SHIFL Glycerol-3-phosphate acyltransferase OS=Shigella flexneri GN=plsB PE=3 SV=1 181 549 4.0E-40
sp|Q0SXQ8|PLSB_SHIF8 Glycerol-3-phosphate acyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=plsB PE=3 SV=1 181 549 4.0E-40
sp|Q0I2G8|PLSB_HAES1 Glycerol-3-phosphate acyltransferase OS=Haemophilus somnus (strain 129Pt) GN=plsB PE=3 SV=1 149 593 4.0E-40
sp|Q22949|PLSB_CAEEL Probable glycerol-3-phosphate acyltransferase, mitochondrial OS=Caenorhabditis elegans GN=acl-6 PE=3 SV=1 86 702 4.0E-40
sp|B8CUW9|PLSB_SHEPW Glycerol-3-phosphate acyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=plsB PE=3 SV=1 97 543 5.0E-40
sp|A8H9R9|PLSB_SHEPA Glycerol-3-phosphate acyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=plsB PE=3 SV=1 97 543 5.0E-40
sp|B7NFY5|PLSB_ECOLU Glycerol-3-phosphate acyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=plsB PE=3 SV=1 182 549 6.0E-40
sp|P0A7A7|PLSB_ECOLI Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12) GN=plsB PE=1 SV=2 182 549 6.0E-40
sp|B1IUL1|PLSB_ECOLC Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=plsB PE=3 SV=1 182 549 6.0E-40
sp|P0A7A8|PLSB_ECOL6 Glycerol-3-phosphate acyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=plsB PE=3 SV=2 182 549 6.0E-40
sp|A8A7E1|PLSB_ECOHS Glycerol-3-phosphate acyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=plsB PE=3 SV=1 182 549 6.0E-40
sp|B1XC40|PLSB_ECODH Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=plsB PE=3 SV=1 182 549 6.0E-40
sp|C5A134|PLSB_ECOBW Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=plsB PE=3 SV=1 182 549 6.0E-40
sp|B7M7V4|PLSB_ECO8A Glycerol-3-phosphate acyltransferase OS=Escherichia coli O8 (strain IAI1) GN=plsB PE=3 SV=1 182 549 6.0E-40
sp|B7N2P8|PLSB_ECO81 Glycerol-3-phosphate acyltransferase OS=Escherichia coli O81 (strain ED1a) GN=plsB PE=3 SV=1 182 549 6.0E-40
sp|B7NS05|PLSB_ECO7I Glycerol-3-phosphate acyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=plsB PE=3 SV=1 182 549 6.0E-40
sp|B7LAY9|PLSB_ECO55 Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=plsB PE=3 SV=1 182 549 6.0E-40
sp|B7MJ31|PLSB_ECO45 Glycerol-3-phosphate acyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=plsB PE=3 SV=1 182 549 6.0E-40
sp|B7UPK2|PLSB_ECO27 Glycerol-3-phosphate acyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=plsB PE=3 SV=1 182 549 6.0E-40
sp|A7ZUR3|PLSB_ECO24 Glycerol-3-phosphate acyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=plsB PE=3 SV=1 182 549 6.0E-40
sp|B2TX75|PLSB_SHIB3 Glycerol-3-phosphate acyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=plsB PE=3 SV=1 182 549 6.0E-40
sp|B5Z182|PLSB_ECO5E Glycerol-3-phosphate acyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=plsB PE=3 SV=1 182 549 6.0E-40
sp|P58130|PLSB_ECO57 Glycerol-3-phosphate acyltransferase OS=Escherichia coli O157:H7 GN=plsB PE=3 SV=2 182 549 6.0E-40
sp|B1LPK6|PLSB_ECOSM Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=plsB PE=3 SV=1 116 549 8.0E-40
sp|Q327U8|PLSB_SHIDS Glycerol-3-phosphate acyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=plsB PE=3 SV=1 182 549 8.0E-40
sp|Q1R3P5|PLSB_ECOUT Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=plsB PE=3 SV=1 182 549 8.0E-40
sp|B6I5Q6|PLSB_ECOSE Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain SE11) GN=plsB PE=3 SV=1 182 549 8.0E-40
sp|A1AIL8|PLSB_ECOK1 Glycerol-3-phosphate acyltransferase OS=Escherichia coli O1:K1 / APEC GN=plsB PE=3 SV=1 182 549 8.0E-40
sp|Q3YUU3|PLSB_SHISS Glycerol-3-phosphate acyltransferase OS=Shigella sonnei (strain Ss046) GN=plsB PE=3 SV=1 182 549 8.0E-40
sp|Q31TU9|PLSB_SHIBS Glycerol-3-phosphate acyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=plsB PE=3 SV=1 182 549 8.0E-40
sp|A9MGP8|PLSB_SALAR Glycerol-3-phosphate acyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=plsB PE=3 SV=1 182 580 9.0E-40
sp|Q8PES0|PLSB_XANAC Glycerol-3-phosphate acyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=plsB PE=3 SV=1 162 551 1.0E-39
sp|A4W5F4|PLSB_ENT38 Glycerol-3-phosphate acyltransferase OS=Enterobacter sp. (strain 638) GN=plsB PE=3 SV=1 116 591 1.0E-39
sp|Q8P3E3|PLSB_XANCP Glycerol-3-phosphate acyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=plsB PE=3 SV=1 162 551 1.0E-39
sp|B7VM97|PLSB_VIBTL Glycerol-3-phosphate acyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=plsB PE=3 SV=1 116 540 1.0E-39
sp|Q7VNI5|PLSB_HAEDU Glycerol-3-phosphate acyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=plsB PE=3 SV=1 149 540 2.0E-39
sp|A4TRU7|PLSB_YERPP Glycerol-3-phosphate acyltransferase OS=Yersinia pestis (strain Pestoides F) GN=plsB PE=3 SV=1 182 546 2.0E-39
sp|Q1CE96|PLSB_YERPN Glycerol-3-phosphate acyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=plsB PE=3 SV=1 182 546 2.0E-39
sp|Q8ZJ18|PLSB_YERPE Glycerol-3-phosphate acyltransferase OS=Yersinia pestis GN=plsB PE=3 SV=1 182 546 2.0E-39
sp|Q1C0T9|PLSB_YERPA Glycerol-3-phosphate acyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=plsB PE=3 SV=1 182 546 2.0E-39
sp|A7FN98|PLSB_YERP3 Glycerol-3-phosphate acyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=plsB PE=3 SV=1 182 546 2.0E-39
sp|B1JNE5|PLSB_YERPY Glycerol-3-phosphate acyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=plsB PE=3 SV=1 182 546 2.0E-39
sp|B2K1U5|PLSB_YERPB Glycerol-3-phosphate acyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=plsB PE=3 SV=1 182 546 2.0E-39
sp|Q66FG9|PLSB_YERPS Glycerol-3-phosphate acyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=plsB PE=3 SV=1 182 546 2.0E-39
sp|Q8DD48|PLSB_VIBVU Glycerol-3-phosphate acyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=plsB PE=3 SV=1 182 540 2.0E-39
sp|Q7MQ86|PLSB_VIBVY Glycerol-3-phosphate acyltransferase OS=Vibrio vulnificus (strain YJ016) GN=plsB PE=3 SV=1 182 540 2.0E-39
sp|Q8Z1T6|PLSB_SALTI Glycerol-3-phosphate acyltransferase OS=Salmonella typhi GN=plsB PE=3 SV=1 182 580 2.0E-39
sp|B5BJV8|PLSB_SALPK Glycerol-3-phosphate acyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=plsB PE=3 SV=1 182 580 2.0E-39
sp|Q5PL16|PLSB_SALPA Glycerol-3-phosphate acyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=plsB PE=3 SV=1 182 580 2.0E-39
sp|Q8ZKH9|PLSB_SALTY Glycerol-3-phosphate acyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=plsB PE=3 SV=1 182 580 2.0E-39
sp|C0Q4E0|PLSB_SALPC Glycerol-3-phosphate acyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=plsB PE=3 SV=1 182 580 2.0E-39
sp|B4T1T0|PLSB_SALNS Glycerol-3-phosphate acyltransferase OS=Salmonella newport (strain SL254) GN=plsB PE=3 SV=1 182 580 2.0E-39
sp|B4TDL8|PLSB_SALHS Glycerol-3-phosphate acyltransferase OS=Salmonella heidelberg (strain SL476) GN=plsB PE=3 SV=1 182 580 2.0E-39
sp|B5R7T4|PLSB_SALG2 Glycerol-3-phosphate acyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=plsB PE=3 SV=1 182 580 2.0E-39
sp|B5QZ60|PLSB_SALEP Glycerol-3-phosphate acyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=plsB PE=3 SV=1 182 580 2.0E-39
sp|B5FQQ9|PLSB_SALDC Glycerol-3-phosphate acyltransferase OS=Salmonella dublin (strain CT_02021853) GN=plsB PE=3 SV=1 182 580 2.0E-39
sp|Q57GZ2|PLSB_SALCH Glycerol-3-phosphate acyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=plsB PE=3 SV=1 182 580 2.0E-39
sp|B5F1Q4|PLSB_SALA4 Glycerol-3-phosphate acyltransferase OS=Salmonella agona (strain SL483) GN=plsB PE=3 SV=1 182 580 2.0E-39
sp|B4TQQ3|PLSB_SALSV Glycerol-3-phosphate acyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=plsB PE=3 SV=1 182 580 2.0E-39
sp|A9N1L4|PLSB_SALPB Glycerol-3-phosphate acyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=plsB PE=3 SV=1 182 580 3.0E-39
sp|A3N1B3|PLSB_ACTP2 Glycerol-3-phosphate acyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=plsB PE=3 SV=1 137 540 3.0E-39
sp|Q5E208|PLSB_VIBF1 Glycerol-3-phosphate acyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=plsB PE=3 SV=1 162 540 5.0E-39
sp|B5FCB3|PLSB_VIBFM Glycerol-3-phosphate acyltransferase OS=Vibrio fischeri (strain MJ11) GN=plsB PE=3 SV=1 162 540 5.0E-39
sp|B6ENU1|PLSB_ALISL Glycerol-3-phosphate acyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=plsB PE=3 SV=1 162 540 6.0E-39
sp|B3GXZ3|PLSB_ACTP7 Glycerol-3-phosphate acyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=plsB PE=3 SV=1 137 540 6.0E-39
sp|B0BQ47|PLSB_ACTPJ Glycerol-3-phosphate acyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=plsB PE=3 SV=1 137 540 6.0E-39
sp|Q87EJ1|PLSB_XYLFT Glycerol-3-phosphate acyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=plsB PE=3 SV=1 162 543 8.0E-39
sp|B2I7N1|PLSB_XYLF2 Glycerol-3-phosphate acyltransferase OS=Xylella fastidiosa (strain M23) GN=plsB PE=3 SV=1 162 543 8.0E-39
sp|A8GKB6|PLSB_SERP5 Glycerol-3-phosphate acyltransferase OS=Serratia proteamaculans (strain 568) GN=plsB PE=3 SV=1 182 550 1.0E-38
sp|A1JRU2|PLSB_YERE8 Glycerol-3-phosphate acyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=plsB PE=3 SV=1 182 594 1.0E-38
sp|A0KEQ0|PLSB_AERHH Glycerol-3-phosphate acyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=plsB PE=3 SV=1 109 540 2.0E-38
sp|Q48AL2|PLSB_COLP3 Glycerol-3-phosphate acyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=plsB PE=3 SV=1 172 540 2.0E-38
sp|B8ECL8|PLSB_SHEB2 Glycerol-3-phosphate acyltransferase OS=Shewanella baltica (strain OS223) GN=plsB PE=3 SV=1 92 543 3.0E-38
sp|A3CYX8|PLSB_SHEB5 Glycerol-3-phosphate acyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=plsB PE=3 SV=1 92 543 3.0E-38
sp|A9KUW7|PLSB_SHEB9 Glycerol-3-phosphate acyltransferase OS=Shewanella baltica (strain OS195) GN=plsB PE=3 SV=1 92 543 3.0E-38
sp|A6WU04|PLSB_SHEB8 Glycerol-3-phosphate acyltransferase OS=Shewanella baltica (strain OS185) GN=plsB PE=3 SV=1 92 543 3.0E-38
sp|Q0HDL6|PLSB_SHESM Glycerol-3-phosphate acyltransferase OS=Shewanella sp. (strain MR-4) GN=plsB PE=3 SV=1 92 543 3.0E-38
sp|B1KM69|PLSB_SHEWM Glycerol-3-phosphate acyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=plsB PE=3 SV=1 97 549 3.0E-38
sp|Q0HPW7|PLSB_SHESR Glycerol-3-phosphate acyltransferase OS=Shewanella sp. (strain MR-7) GN=plsB PE=3 SV=1 92 543 5.0E-38
sp|A0L2D7|PLSB_SHESA Glycerol-3-phosphate acyltransferase OS=Shewanella sp. (strain ANA-3) GN=plsB PE=3 SV=1 92 543 6.0E-38
sp|Q8E8Q9|PLSB_SHEON Glycerol-3-phosphate acyltransferase OS=Shewanella oneidensis (strain MR-1) GN=plsB PE=3 SV=1 133 543 7.0E-38
sp|A5F4F5|PLSB_VIBC3 Glycerol-3-phosphate acyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=plsB PE=3 SV=1 182 540 1.0E-37
sp|C3LPT5|PLSB_VIBCM Glycerol-3-phosphate acyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=plsB PE=3 SV=1 182 540 1.0E-37
sp|Q9KVP8|PLSB_VIBCH Glycerol-3-phosphate acyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=plsB PE=3 SV=1 182 540 1.0E-37
sp|A8FPP1|PLSB_SHESH Glycerol-3-phosphate acyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=plsB PE=3 SV=1 97 543 2.0E-37
sp|Q089E1|PLSB_SHEFN Glycerol-3-phosphate acyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=plsB PE=3 SV=1 135 543 3.0E-37
sp|C5B706|PLSB_EDWI9 Glycerol-3-phosphate acyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=plsB PE=3 SV=1 182 540 3.0E-37
sp|C4K8M7|PLSB_HAMD5 Glycerol-3-phosphate acyltransferase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=plsB PE=3 SV=1 181 543 3.0E-37
sp|A1RE94|PLSB_SHESW Glycerol-3-phosphate acyltransferase OS=Shewanella sp. (strain W3-18-1) GN=plsB PE=3 SV=1 92 543 6.0E-37
sp|Q1LU65|PLSB_BAUCH Glycerol-3-phosphate acyltransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=plsB PE=3 SV=1 102 541 8.0E-37
sp|A4YC03|PLSB_SHEPC Glycerol-3-phosphate acyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=plsB PE=3 SV=1 92 543 1.0E-36
sp|Q7MZB7|PLSB_PHOLL Glycerol-3-phosphate acyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=plsB PE=3 SV=1 182 549 2.0E-36
sp|Q3IF27|PLSB_PSEHT Glycerol-3-phosphate acyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=plsB PE=3 SV=1 91 393 1.0E-35
sp|C6DKD0|PLSB_PECCP Glycerol-3-phosphate acyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=plsB PE=3 SV=1 182 540 3.0E-35
sp|Q2NR08|PLSB_SODGM Glycerol-3-phosphate acyltransferase OS=Sodalis glossinidius (strain morsitans) GN=plsB PE=3 SV=1 116 396 7.0E-35
sp|Q6D9I7|PLSB_PECAS Glycerol-3-phosphate acyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=plsB PE=3 SV=1 182 540 7.0E-35
sp|Q9X7B0|PLSB_MYCLE Glycerol-3-phosphate acyltransferase OS=Mycobacterium leprae (strain TN) GN=plsB PE=3 SV=1 175 543 6.0E-34
sp|B8ZRA3|PLSB_MYCLB Glycerol-3-phosphate acyltransferase OS=Mycobacterium leprae (strain Br4923) GN=plsB PE=3 SV=1 175 543 6.0E-34
sp|P9WI60|PLSB_MYCTO Glycerol-3-phosphate acyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plsB PE=3 SV=1 197 581 8.0E-33
sp|P9WI61|PLSB_MYCTU Glycerol-3-phosphate acyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plsB PE=1 SV=1 197 581 9.0E-33
sp|A5U5H8|PLSB_MYCTA Glycerol-3-phosphate acyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=plsB PE=3 SV=1 197 581 9.0E-33
sp|C1AEU7|PLSB_MYCBT Glycerol-3-phosphate acyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=plsB PE=3 SV=1 197 581 9.0E-33
sp|A1KLH6|PLSB_MYCBP Glycerol-3-phosphate acyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=plsB PE=3 SV=1 197 581 9.0E-33
sp|Q7TYH5|PLSB_MYCBO Glycerol-3-phosphate acyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=plsB PE=3 SV=1 197 581 4.0E-32
sp|P9WI59|PLSB1_MYCTU Putative acyltransferase plsB1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plsB1 PE=1 SV=1 169 581 2.0E-31
sp|P9WI58|PLSB1_MYCTO Putative acyltransferase plsB1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plsB1 PE=3 SV=1 169 581 2.0E-31
sp|P65735|PLSB1_MYCBO Putative acyltransferase plsB1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=plsB1 PE=3 SV=1 169 581 2.0E-31
sp|B2HNJ0|PLSB_MYCMM Glycerol-3-phosphate acyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=plsB PE=3 SV=1 210 593 1.0E-29
[Show less]

GO

GO Term Description Terminal node
GO:0016746 acyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4404
MAKGDDSFDPASGSAPDLQILGDEITLQPSGFVETQGSVEGREEALMNQFASFRAEPLQFLREVSLYVSGQGWRA
YDRVVGQPVFYPGFTERMKSSVMSAPLLQRRISELAEDRVAVEDKEGFFRNDKDHNIKRAQRRAVLENGLQEVAE
KLTDDMICKMESKTFIRGAYYFVTQLLTRAYHQGIHVSSEEVLRLRKVADMAAKMKKSIIFLPSHRSHVDYVSLQ
LICYRLGLTLPVVVAGDNLNFPLVGSFLQHAGAMWIRRSFGDDALYTALVQSYVDVLLQEGYNFECFIEGGRSRT
GKLLPPKFGILSFILDSLLSGRVDDAIICPVSTQYDKVIETEGYVTELLGMPKKKENLADFLSGGSSVLSLQLGR
VDVRFHEPWSLRKFIDEQLSRLPVVPAGLDTEHERPQVKAVREKLLRTLGYKVLGDINDVSVVMPTALIGTVLLT
LRGRGVGKQELTRRVEWLTARIQAKGGRVAHFGNAPLSEIVDRGLEVLGKDLVGVVDGLLEPTYYAVDRFQLSFY
RNMTIHLFIYEALVSVSMYTRVKRGGGPSMQDMSHADLRAHVLFLSTLFRGEFIFSPAGLDANLDKTLRGLEADH
VVRLDRDANGNVTTVGLAPEERRAGRENYDFYCFLLWPFIEASWLAAVSLMGLAPLLGDEEGDVWLEQAKAQDSA
QLLGKTLYHQGDLSYFEAVNKETLKNSYSRFEQDQMMHVVKSRDPKIPPRIQLDAAWRPARDPETGALLAEGKLW
DFTEKIASARREGKNRRDGATVSSRVLRLTDELGRRLFAEAKADDERGVKARVPSRLSREDRLALKRSVEDAKRR
RKPGRARL*
Coding >Ophun1|4404
ATGGCCAAGGGCGACGACTCTTTCGACCCGGCCAGCGGCTCGGCTCCTGACCTGCAAATACTAGGCGATGAGATC
ACGCTGCAACCCAGCGGCTTTGTCGAGACGCAGGGCTCCGTCGAGGGCAGGGAGGAGGCCTTGATGAACCAGTTT
GCCTCGTTCCGCGCCGAGCCGCTGCAGTTTCTTCGCGAAGTGTCGCTGTACGTCTCCGGTCAGGGATGGCGCGCC
TACGATCGGGTCGTCGGCCAGCCCGTCTTCTACCCGGGCTTCACCGAGCGCATGAAGTCGTCCGTCATGTCGGCC
CCCTTGCTCCAGCGGCGCATCTCGGAGCTGGCCGAAGACCGGGTCGCGGTCGAGGATAAGGAGGGCTTCTTCCGC
AACGACAAGGACCACAACATCAAGCGGGCTCAGCGACGGGCGGTGCTCGAGAACGGGCTGCAGGAGGTGGCGGAG
AAGCTGACGGACGACATGATTTGCAAGATGGAGAGCAAGACGTTCATCCGCGGCGCCTACTACTTTGTGACGCAG
CTTCTTACGCGGGCCTATCATCAGGGCATTCACGTGTCGAGCGAAGAGGTGCTCCGACTGCGCAAGGTGGCCGAT
ATGGCGGCCAAGATGAAGAAGAGCATCATCTTCCTTCCGAGCCACCGGTCACACGTGGACTATGTCTCGCTACAG
CTCATCTGCTACCGGCTCGGGCTGACGCTGCCGGTGGTGGTTGCGGGAGACAACCTCAACTTTCCGCTGGTGGGC
AGCTTCCTACAACACGCGGGCGCCATGTGGATTCGGAGGTCGTTTGGCGACGACGCGCTATACACGGCGCTGGTC
CAGTCGTATGTGGACGTGCTCCTGCAGGAAGGCTACAACTTTGAATGCTTCATCGAGGGTGGACGGTCGCGGACG
GGCAAGTTGCTGCCGCCCAAGTTTGGTATCCTCAGCTTCATCCTCGACAGCCTATTGTCGGGCCGCGTTGACGAC
GCCATCATTTGCCCGGTCAGCACGCAGTACGACAAGGTCATCGAGACCGAAGGCTACGTGACGGAACTGCTGGGC
ATGCCCAAGAAGAAGGAGAACCTGGCCGACTTCTTGTCTGGAGGGTCATCGGTGCTATCACTGCAACTCGGCCGC
GTCGACGTGCGCTTCCACGAGCCATGGAGCCTGCGCAAGTTCATCGACGAGCAGCTTTCTCGCCTTCCCGTCGTA
CCAGCCGGCCTCGACACTGAGCATGAGCGGCCACAGGTCAAGGCGGTGCGGGAGAAGCTGCTCCGGACTCTGGGC
TACAAGGTGCTGGGAGACATCAACGACGTGTCGGTGGTGATGCCAACGGCCCTCATCGGAACCGTCCTGCTGACG
CTCCGGGGCCGTGGTGTTGGCAAGCAGGAGCTCACGCGGAGGGTAGAGTGGCTGACGGCCCGGATCCAGGCCAAG
GGCGGACGCGTCGCTCACTTTGGAAACGCGCCGCTGTCCGAGATTGTCGACCGCGGGCTCGAGGTGCTGGGCAAG
GATCTGGTGGGCGTCGTCGACGGCCTGCTGGAGCCGACTTACTACGCTGTGGACCGCTTCCAGCTCTCGTTTTAC
CGCAACATGACGATTCATCTGTTCATCTACGAGGCCCTCGTCAGCGTCTCCATGTACACGCGAGTGAAACGTGGT
GGCGGACCGTCGATGCAGGACATGTCACACGCCGATCTCCGTGCTCACGTCCTCTTCCTCTCGACGCTCTTCCGC
GGCGAATTCATCTTCTCACCCGCCGGTCTCGACGCCAACCTGGATAAGACACTTCGCGGGCTCGAGGCCGATCAC
GTCGTTCGCCTCGACCGCGATGCTAATGGCAACGTGACGACGGTCGGCCTCGCGCCCGAGGAACGTCGAGCCGGG
CGTGAGAACTACGACTTCTACTGCTTCCTTCTGTGGCCTTTTATCGAGGCTAGCTGGCTGGCTGCCGTGTCGCTG
ATGGGTCTGGCGCCACTGCTTGGCGATGAAGAGGGTGACGTTTGGCTTGAACAGGCCAAGGCGCAGGACAGCGCG
CAGCTGCTCGGCAAGACGCTCTACCATCAAGGCGACCTCTCCTACTTTGAAGCCGTCAACAAGGAGACGCTCAAG
AACTCGTACTCTCGCTTCGAGCAGGACCAGATGATGCACGTCGTCAAATCGCGTGACCCCAAGATCCCCCCGAGG
ATCCAACTCGACGCCGCCTGGCGTCCAGCCCGTGACCCGGAGACGGGCGCGCTGCTAGCCGAGGGCAAGCTCTGG
GACTTTACCGAGAAGATCGCCAGCGCGCGTCGCGAGGGTAAGAATCGGCGTGACGGCGCAACCGTCAGCTCGCGC
GTCCTTCGCCTCACCGATGAGCTTGGACGGAGGCTCTTTGCCGAGGCCAAGGCTGATGACGAAAGGGGCGTCAAG
GCGAGGGTGCCGAGCAGGTTGAGTCGTGAGGATAGGCTTGCGCTGAAGAGGAGCGTTGAGGATGCTAAGAGGAGG
AGGAAGCCGGGGAGAGCTCGTCTGTGA
Transcript >Ophun1|4404
ATGGCCAAGGGCGACGACTCTTTCGACCCGGCCAGCGGCTCGGCTCCTGACCTGCAAATACTAGGCGATGAGATC
ACGCTGCAACCCAGCGGCTTTGTCGAGACGCAGGGCTCCGTCGAGGGCAGGGAGGAGGCCTTGATGAACCAGTTT
GCCTCGTTCCGCGCCGAGCCGCTGCAGTTTCTTCGCGAAGTGTCGCTGTACGTCTCCGGTCAGGGATGGCGCGCC
TACGATCGGGTCGTCGGCCAGCCCGTCTTCTACCCGGGCTTCACCGAGCGCATGAAGTCGTCCGTCATGTCGGCC
CCCTTGCTCCAGCGGCGCATCTCGGAGCTGGCCGAAGACCGGGTCGCGGTCGAGGATAAGGAGGGCTTCTTCCGC
AACGACAAGGACCACAACATCAAGCGGGCTCAGCGACGGGCGGTGCTCGAGAACGGGCTGCAGGAGGTGGCGGAG
AAGCTGACGGACGACATGATTTGCAAGATGGAGAGCAAGACGTTCATCCGCGGCGCCTACTACTTTGTGACGCAG
CTTCTTACGCGGGCCTATCATCAGGGCATTCACGTGTCGAGCGAAGAGGTGCTCCGACTGCGCAAGGTGGCCGAT
ATGGCGGCCAAGATGAAGAAGAGCATCATCTTCCTTCCGAGCCACCGGTCACACGTGGACTATGTCTCGCTACAG
CTCATCTGCTACCGGCTCGGGCTGACGCTGCCGGTGGTGGTTGCGGGAGACAACCTCAACTTTCCGCTGGTGGGC
AGCTTCCTACAACACGCGGGCGCCATGTGGATTCGGAGGTCGTTTGGCGACGACGCGCTATACACGGCGCTGGTC
CAGTCGTATGTGGACGTGCTCCTGCAGGAAGGCTACAACTTTGAATGCTTCATCGAGGGTGGACGGTCGCGGACG
GGCAAGTTGCTGCCGCCCAAGTTTGGTATCCTCAGCTTCATCCTCGACAGCCTATTGTCGGGCCGCGTTGACGAC
GCCATCATTTGCCCGGTCAGCACGCAGTACGACAAGGTCATCGAGACCGAAGGCTACGTGACGGAACTGCTGGGC
ATGCCCAAGAAGAAGGAGAACCTGGCCGACTTCTTGTCTGGAGGGTCATCGGTGCTATCACTGCAACTCGGCCGC
GTCGACGTGCGCTTCCACGAGCCATGGAGCCTGCGCAAGTTCATCGACGAGCAGCTTTCTCGCCTTCCCGTCGTA
CCAGCCGGCCTCGACACTGAGCATGAGCGGCCACAGGTCAAGGCGGTGCGGGAGAAGCTGCTCCGGACTCTGGGC
TACAAGGTGCTGGGAGACATCAACGACGTGTCGGTGGTGATGCCAACGGCCCTCATCGGAACCGTCCTGCTGACG
CTCCGGGGCCGTGGTGTTGGCAAGCAGGAGCTCACGCGGAGGGTAGAGTGGCTGACGGCCCGGATCCAGGCCAAG
GGCGGACGCGTCGCTCACTTTGGAAACGCGCCGCTGTCCGAGATTGTCGACCGCGGGCTCGAGGTGCTGGGCAAG
GATCTGGTGGGCGTCGTCGACGGCCTGCTGGAGCCGACTTACTACGCTGTGGACCGCTTCCAGCTCTCGTTTTAC
CGCAACATGACGATTCATCTGTTCATCTACGAGGCCCTCGTCAGCGTCTCCATGTACACGCGAGTGAAACGTGGT
GGCGGACCGTCGATGCAGGACATGTCACACGCCGATCTCCGTGCTCACGTCCTCTTCCTCTCGACGCTCTTCCGC
GGCGAATTCATCTTCTCACCCGCCGGTCTCGACGCCAACCTGGATAAGACACTTCGCGGGCTCGAGGCCGATCAC
GTCGTTCGCCTCGACCGCGATGCTAATGGCAACGTGACGACGGTCGGCCTCGCGCCCGAGGAACGTCGAGCCGGG
CGTGAGAACTACGACTTCTACTGCTTCCTTCTGTGGCCTTTTATCGAGGCTAGCTGGCTGGCTGCCGTGTCGCTG
ATGGGTCTGGCGCCACTGCTTGGCGATGAAGAGGGTGACGTTTGGCTTGAACAGGCCAAGGCGCAGGACAGCGCG
CAGCTGCTCGGCAAGACGCTCTACCATCAAGGCGACCTCTCCTACTTTGAAGCCGTCAACAAGGAGACGCTCAAG
AACTCGTACTCTCGCTTCGAGCAGGACCAGATGATGCACGTCGTCAAATCGCGTGACCCCAAGATCCCCCCGAGG
ATCCAACTCGACGCCGCCTGGCGTCCAGCCCGTGACCCGGAGACGGGCGCGCTGCTAGCCGAGGGCAAGCTCTGG
GACTTTACCGAGAAGATCGCCAGCGCGCGTCGCGAGGGTAAGAATCGGCGTGACGGCGCAACCGTCAGCTCGCGC
GTCCTTCGCCTCACCGATGAGCTTGGACGGAGGCTCTTTGCCGAGGCCAAGGCTGATGACGAAAGGGGCGTCAAG
GCGAGGGTGCCGAGCAGGTTGAGTCGTGAGGATAGGCTTGCGCTGAAGAGGAGCGTTGAGGATGCTAAGAGGAGG
AGGAAGCCGGGGAGAGCTCGTCTGTGA
Gene >Ophun1|4404
ATGGCCAAGGGCGACGACTCTTTCGACCCGGCCAGCGGCTCGGCTCCTGACCTGCAAATACTAGGCGATGAGATC
ACGCTGCAACCCAGCGGCTTTGTCGAGACGCAGGGCTCCGTCGAGGGCAGGGAGGAGGCCTTGATGAACCAGTTT
GCCTCGTTCCGCGCCGAGCCGCTGCAGTCAGTGGCCATGTGTCGTCCATGTTGAACGAATTGTCGCTGATTTCCT
GGTGTTCTTTAGGTTTCTTCGCGAAGTGTCGCTGTACGTCTCCGGTCAGGGATGGCGCGCCTACGATCGGGTCGT
CGGCCAGCCCGTCTTCTACCCGGGCTTCACCGAGCGCATGAAGTCGTCCGTCATGTCGGCCCCCTTGCTCCAGCG
GCGCATCTCGGAGCTGGCCGAAGACCGGGTCGCGGTCGAGGATAAGGAGGGCTTCTTCCGCAACGACAAGGACCA
CAACATCAAGCGGGCTCAGCGACGGGCGGTGCTCGAGAACGGGCTGCAGGAGGTGGCGGAGAAGCTGACGGACGA
CATGATTTGCAAGATGGAGAGCAAGACGTTCATCCGCGGCGCCTACTACTTTGTGACGCAGCTTCTTACGCGGGC
CTATCATCAGGGCATTCACGTGTCGAGCGAAGAGGTGCTCCGACTGCGCAAGGTGGCCGATATGGCGGCCAAGAT
GAAGAAGAGCATCATCTTCCTTCCGAGCCACCGGTCACACGTGGACTATGTCTCGCTACAGCTCATCTGCTACCG
GCTCGGGCTGACGCTGCCGGTGGTGGTTGCGGGAGACAACCTCAACTTTCCGCTGGTGGGCAGCTTCCTACAACA
CGCGGGCGCCATGTGGATTCGGAGGTCGTTTGGCGACGACGCGCTATACACGGCGCTGGTCCAGTCGTATGTGGA
CGTGCTCCTGCAGGAAGGCTACAACTTTGAATGCTTCATCGAGGGTGGACGGTCGCGGACGGGCAAGTTGCTGCC
GCCCAAGTTTGGTATCCTCAGCTTCATCCTCGACAGCCTATTGTCGGGCCGCGTTGACGACGCCATCATTTGCCC
GGTCAGCACGCAGTACGACAAGGTCATCGAGACCGAAGGCTACGTGACGGAACTGCTGGGCATGCCCAAGAAGAA
GGAGAACCTGGCCGACTTCTTGTCTGGAGGGTCATCGGTGCTATCACTGCAACTCGGCCGCGTCGACGTGCGCTT
CCACGAGCCATGGAGCCTGCGCAAGTTCATCGACGAGCAGCTTTCTCGCCTTCCCGTCGTACCAGCCGGCCTCGA
CACTGAGCATGAGCGGCCACAGGTCAAGGCGGTGCGGGAGAAGCTGCTCCGGACTCTGGGCTACAAGGTGCTGGG
AGACATCAACGACGTGTCGGTGGTGATGCCAACGGCCCTCATCGGAACCGTCCTGCTGACGCTCCGGGGCCGTGG
TGTTGGCAAGCAGGAGCTCACGCGGAGGGTAGAGTGGCTGACGGCCCGGATCCAGGCCAAGGGCGGACGCGTCGC
TCACTTTGGAAACGCGCCGCTGTCCGAGATTGTCGACCGCGGGCTCGAGGTGCTGGGCAAGGATCTGGTGGGCGT
CGTCGACGGCCTGCTGGAGCCGACTTACTACGCTGTGGACCGCTTCCAGCTCTCGTTTTACCGCAACATGACGAT
TCATCTGTTCATCTACGAGGCCCTCGTCAGCGTCTCCATGTACACGCGAGTGAAACGTGGTGGCGGACCGTCGAT
GCAGGACATGTCACACGCCGATCTCCGTGCTCACGTCCTCTTCCTCTCGACGCTCTTCCGCGGCGAATTCATCTT
CTCACCCGCCGGTCTCGACGCCAACCTGGATAAGACACTTCGCGGGCTCGAGGCCGATCACGTCGTTCGCCTCGA
CCGCGATGCTAATGGCAACGTGACGACGGTCGGCCTCGCGCCCGAGGAACGTCGAGCCGGGCGTGAGAACTACGA
CTTCTACTGCTTCCTTCTGTGGCCTTTTATCGAGGCTAGCTGGCTGGCTGCCGTGTCGCTGATGGGTCTGGCGCC
ACTGCTTGGCGATGAAGAGGGTGACGTTTGGCTTGAACAGGCCAAGGCGCAGGACAGCGCGCAGCTGGTGGGTTT
CCCCCTTATCCCTTGGTTTATTGGTTTACTTGAGCCTGACTGAAGATATTGGGAACAGCTCGGCAAGACGCTCTA
CCATCAAGGCGACCTCTCCTACTTTGAAGCCGTCAACAAGGAGACGCTCAAGAACTCGTACTCTCGCTTCGAGCA
GGACCAGATGATGCACGTCGTCAAATCGCGTGACCCCAAGATCCCCCCGAGGATCCAACTCGACGCCGCCTGGCG
TCCAGCCCGTGACCCGGAGACGGGCGCGCTGCTAGCCGAGGGCAAGCTCTGGGACTTTACCGAGAAGATCGCCAG
CGCGCGTCGCGAGGGTAAGAATCGGCGTGACGGCGCAACCGTCAGCTCGCGCGTCCTTCGCCTCACCGATGAGCT
TGGACGGAGGCTCTTTGCCGAGGCCAAGGCTGATGACGAAAGGGGCGTCAAGGCGAGGGTGCCGAGCAGGTTGAG
TCGTGAGGATAGGCTTGCGCTGAAGAGGAGCGTTGAGGATGCTAAGAGGAGGAGGAAGCCGGGGAGAGCTCGTCT
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail