Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4402
Gene name
LocationContig_405:1275..6030
Strand-
Gene length (bp)4755
Transcript length (bp)4422
Coding sequence length (bp)4422
Protein length (aa) 1474

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02213 GYF GYF domain 5.4E-19 696 740

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O36025|MPD2_SCHPO GYF domain-containing protein mpd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpd2 PE=1 SV=1 688 790 3.0E-16
sp|Q7KQM6|PERQ1_DROME PERQ amino acid-rich with GYF domain-containing protein CG11148 OS=Drosophila melanogaster GN=CG11148 PE=1 SV=2 696 745 1.0E-10
sp|Q5U236|PERQ2_XENLA PERQ amino acid-rich with GYF domain-containing protein 2 OS=Xenopus laevis GN=gigyf2 PE=2 SV=1 690 757 2.0E-10
sp|Q6Y7W8|PERQ2_MOUSE PERQ amino acid-rich with GYF domain-containing protein 2 OS=Mus musculus GN=Gigyf2 PE=1 SV=2 695 748 1.0E-09
sp|Q6Y7W6|PERQ2_HUMAN PERQ amino acid-rich with GYF domain-containing protein 2 OS=Homo sapiens GN=GIGYF2 PE=1 SV=1 695 748 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O36025|MPD2_SCHPO GYF domain-containing protein mpd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpd2 PE=1 SV=1 688 790 3.0E-16
sp|Q7KQM6|PERQ1_DROME PERQ amino acid-rich with GYF domain-containing protein CG11148 OS=Drosophila melanogaster GN=CG11148 PE=1 SV=2 696 745 1.0E-10
sp|Q5U236|PERQ2_XENLA PERQ amino acid-rich with GYF domain-containing protein 2 OS=Xenopus laevis GN=gigyf2 PE=2 SV=1 690 757 2.0E-10
sp|Q6Y7W8|PERQ2_MOUSE PERQ amino acid-rich with GYF domain-containing protein 2 OS=Mus musculus GN=Gigyf2 PE=1 SV=2 695 748 1.0E-09
sp|Q6Y7W6|PERQ2_HUMAN PERQ amino acid-rich with GYF domain-containing protein 2 OS=Homo sapiens GN=GIGYF2 PE=1 SV=1 695 748 1.0E-09
sp|Q4KME6|PERQ2_DANRE PERQ amino acid-rich with GYF domain-containing protein 2 OS=Danio rerio GN=gigyf2 PE=2 SV=1 694 754 2.0E-09
sp|O75420|PERQ1_HUMAN PERQ amino acid-rich with GYF domain-containing protein 1 OS=Homo sapiens GN=GIGYF1 PE=1 SV=2 695 749 2.0E-09
sp|Q99MR1|PERQ1_MOUSE PERQ amino acid-rich with GYF domain-containing protein 1 OS=Mus musculus GN=Gigyf1 PE=1 SV=2 695 749 2.0E-09
sp|O36025|MPD2_SCHPO GYF domain-containing protein mpd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpd2 PE=1 SV=1 1289 1473 3.0E-09
sp|Q09237|YQ83_CAEEL GYF domain-containing protein C18H9.3 OS=Caenorhabditis elegans GN=C18H9.3/C18H9.2 PE=3 SV=3 688 828 5.0E-08
sp|P32909|SMY2_YEAST Protein SMY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMY2 PE=1 SV=2 1354 1473 8.0E-07
sp|Q02875|SYH1_YEAST SMY2 homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYH1 PE=1 SV=1 673 755 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4402
MRIVTHEVPGETGGELLEEIANGTLTFRRSSTTPTGHAPNPSPSHDHAVQPPSVEESPQATSAHEPGPSRYTKDE
LLDMFRSQKPTDDPSHLFMSGWNPASINGSSARSWGRTSDSPVPQEPGACWDSSGVTTPMGLQGFSLEEKEVGWS
TRLLYAGSAHIHRQAFSADINSPLKPPTQKGDGHQGIINGRKSSVSHGTGNAFGVGSPASTSRQGTRRRETMESN
PFGGGGLVSPTTASSSRFSRDESSPWPARKSNDLKESEPDEADADHGPRDASAKSSAGSLPRIGTSVGGTGVSAI
WPPQGQITPGVGGFGNFALPHSSVVGDKRVGGGVGGGGSRLAHLIPKESHDNSSKAGDGQQSFWRSRPRTDTDPF
GGDEELSGSAVLGGSQDITVGGHAHVGRVGVLGTPIKASTGEFGMSGLAIAGQMGDNGPVSPSETNPYRSPPAER
HDVDDGDGAGVERAHAANQHEQHANFASAARGFGAAAFEGSDRSQTSSVGPKGYSLSGLSGWPAPGVPSAGTPDR
ERQGFGNAFGSSLFSPVGDLQSPGLSNLSNVVFGPGNISRGSKLGSLFPPVMQAQMQSHEPDHGLSDSAPDPRQT
NPLGAIGRGSIAGPSRDTESPMRSARGMFEDLFPSSDVGRSHGAFHAMEATQPTGAAPGSQSFTPVSGEMAFGPQ
SGNEPPVSQVRQMVMPDRMRWVYLDPQGQVQGPFTGLEMNDWYKANFFTPDLRVKKVEDPEFEPLGQLIRRIGNS
REPFLVPQIGIPHGPPSQSGPFTSSTNGGGVVPPLSGVFPSFGRTLTAEEQNNLERRKQEEQYLMAQQREFMLRQ
QAMTKFQIQGGPGLQHHSSVHSLQSQPSFGSMASPIGVAPPPLPPPQQQQQQQHQPHQPQHQPQQAPPPIGSMPL
GIFSDHGAGGQPAMRVAPGGTELLRTDDLASLGLTERQVLGSLQGDELGAQQHERATQGDSGMRSGLPEMSQLAD
DPEGFRERFQEFETLRAQHEEETASDSKATETPSPSAEFSDLTPSAGQPPLTSAPSGKAGKAARRKNAAEEAAAA
AAAAAAALSLTQQVQKTQAAAAVEPDMPMPFPPPSSSTPLPAPTAQRVRSNLPEQYSRSQSGSPEAVQPPPMAPW
AKEPGVEGQKGPSLKEIQEAETRKAARAEEAAAALRKASLEQENALLREKERRASASTAAGLPPTSTWGHGSPVL
SSGPWSKPGPAKGPAPGLQNASTTATSKKTLAEIQREEEVRKQKSRDRDGGAHPSATSGSSKSYANLAGKPGQTA
AAAAANTAAAGSGWATVGAGGKVKAPTGPAAVPGRGGSAKTAGSVVKVVSKPAANNNSSNNNTNAGANGRTESTS
AAMEEFSKWTRRELSRGLTNVTDISEFQADLDALPLDTGVIADAVYINSKTMDGRHFAEEYVRRKKLAEKGIAEK
QQLPVDSGKSGAGWSEVAKRSGGGAQTKDGDAGGVGFKVVPNRKKGKK*
Coding >Ophun1|4402
ATGCGAATCGTGACGCACGAGGTGCCAGGGGAGACGGGAGGGGAGCTGCTGGAGGAGATTGCTAATGGAACTCTG
ACCTTCCGACGGTCATCGACAACCCCCACCGGCCATGCTCCGAATCCCTCTCCCTCTCACGACCACGCCGTTCAG
CCTCCCAGCGTTGAAGAATCGCCCCAGGCTACGTCCGCGCATGAGCCCGGCCCCTCGCGCTACACCAAGGACGAG
CTTCTCGACATGTTTCGCTCTCAAAAGCCCACTGACGATCCGTCGCACCTGTTCATGTCTGGATGGAACCCTGCT
AGCATCAATGGTAGCAGTGCGAGGTCCTGGGGCAGGACCAGCGACAGTCCCGTCCCGCAAGAGCCCGGCGCTTGC
TGGGACTCCAGCGGCGTCACCACTCCCATGGGCTTACAGGGCTTTTCGCTTGAGGAAAAAGAGGTAGGCTGGAGC
ACCAGGCTGCTCTACGCAGGCTCAGCTCACATACATCGCCAGGCCTTTTCCGCCGACATCAATTCGCCCTTGAAA
CCTCCTACCCAGAAAGGGGACGGTCATCAGGGCATCATCAACGGCAGAAAATCCTCCGTGTCCCACGGCACCGGC
AATGCCTTTGGCGTGGGCTCCCCTGCCTCTACCTCGCGTCAGGGAACGAGACGCCGTGAGACTATGGAGTCGAAT
CCTTTTGGCGGTGGCGGTCTCGTCTCACCCACGACCGCCAGCTCGAGCCGCTTCTCGCGTGATGAGTCTTCGCCA
TGGCCGGCGCGCAAATCCAACGATCTCAAGGAATCGGAGCCCGACGAGGCTGACGCAGACCATGGCCCTCGTGAC
GCCTCGGCCAAGTCTTCGGCCGGCAGCCTCCCTCGAATCGGCACCTCGGTTGGTGGCACCGGCGTCAGTGCAATC
TGGCCTCCGCAGGGCCAGATTACGCCCGGTGTAGGCGGCTTCGGTAACTTTGCTCTGCCTCACTCTTCCGTTGTC
GGCGACAAGCGCGTCGGTGGCGGCGTCGGTGGCGGTGGCAGCCGACTCGCCCACCTCATTCCCAAGGAAAGCCAC
GACAACTCGTCCAAAGCCGGAGACGGCCAGCAGTCATTCTGGCGCTCCCGTCCGCGGACCGACACGGACCCCTTT
GGCGGCGACGAGGAACTGTCGGGGAGCGCTGTCCTCGGCGGTTCCCAGGATATCACCGTCGGGGGACACGCGCAC
GTCGGCCGGGTTGGCGTCTTGGGAACGCCCATCAAGGCGTCGACCGGAGAGTTTGGCATGTCGGGCCTGGCCATC
GCTGGTCAGATGGGTGACAATGGCCCCGTCAGTCCGTCGGAGACCAACCCCTACCGCAGCCCTCCGGCCGAGCGT
CACGATGTCGACGACGGTGACGGTGCCGGCGTCGAGCGGGCCCATGCGGCCAACCAGCACGAGCAGCACGCCAAC
TTCGCCTCCGCCGCTCGAGGCTTTGGTGCGGCGGCCTTTGAGGGCAGTGATCGTAGCCAGACCTCTAGCGTGGGT
CCCAAGGGATACTCTCTCAGCGGCCTGTCTGGCTGGCCAGCTCCTGGCGTCCCCTCGGCCGGCACGCCCGATCGC
GAGCGCCAGGGTTTCGGAAACGCCTTTGGCAGTTCCCTCTTCAGCCCGGTCGGCGATCTCCAGTCTCCCGGACTC
TCCAACCTGAGCAACGTCGTCTTTGGGCCTGGTAACATTAGTCGCGGAAGCAAGCTCGGCTCCCTCTTCCCTCCC
GTCATGCAAGCACAGATGCAGTCCCACGAGCCCGACCACGGCCTATCCGACTCCGCCCCGGACCCGCGGCAGACC
AATCCGCTCGGGGCCATCGGTCGGGGAAGCATAGCCGGCCCTTCGCGGGACACGGAGAGTCCGATGCGATCGGCT
CGCGGCATGTTCGAGGATCTCTTCCCGTCCAGCGACGTCGGGAGGTCGCACGGGGCCTTTCACGCCATGGAGGCG
ACGCAGCCGACGGGCGCCGCGCCGGGTTCTCAGTCGTTTACGCCAGTCAGTGGCGAGATGGCTTTCGGCCCTCAG
TCCGGAAACGAGCCCCCCGTCTCTCAGGTCCGTCAGATGGTGATGCCGGATCGGATGAGATGGGTCTACCTCGAT
CCTCAGGGTCAGGTCCAGGGCCCGTTTACTGGGCTCGAGATGAACGACTGGTACAAGGCCAACTTCTTCACGCCC
GACCTCCGAGTCAAAAAGGTCGAGGATCCCGAGTTCGAGCCCCTGGGTCAGCTCATCAGGCGCATCGGTAACTCC
AGAGAACCGTTTCTTGTGCCCCAGATCGGGATCCCCCACGGGCCACCGTCACAGAGCGGACCCTTCACCTCGTCG
ACCAACGGCGGCGGCGTCGTGCCTCCTCTCAGCGGCGTCTTCCCCAGCTTTGGGAGGACGTTGACAGCCGAAGAG
CAGAACAATCTGGAACGGCGCAAACAGGAGGAACAGTACCTCATGGCCCAACAGAGGGAGTTTATGTTGCGACAG
CAGGCCATGACCAAGTTTCAGATACAGGGAGGGCCCGGCTTGCAACATCACTCCAGCGTCCACAGCCTTCAGAGC
CAGCCCAGTTTCGGCAGCATGGCTTCGCCGATCGGGGTCGCGCCGCCGCCGCTTCCACCTCCGCAGCAGCAACAG
CAGCAACAGCACCAGCCGCACCAGCCGCAGCACCAACCGCAGCAGGCACCACCGCCCATAGGCTCGATGCCCCTC
GGAATCTTCTCTGATCATGGTGCGGGCGGTCAGCCAGCCATGCGTGTCGCTCCGGGAGGCACCGAGTTGCTGAGG
ACGGACGATTTGGCGAGCCTCGGTTTGACGGAGCGTCAGGTCTTGGGCTCCTTGCAGGGCGATGAGTTGGGAGCA
CAGCAGCACGAGCGAGCCACGCAGGGTGACTCGGGCATGAGATCGGGACTGCCCGAGATGAGCCAGCTTGCAGAT
GACCCGGAAGGCTTCAGAGAGCGCTTCCAAGAGTTTGAGACGCTGCGGGCCCAGCACGAAGAGGAAACGGCGAGT
GATAGCAAGGCCACCGAAACCCCGTCTCCTTCGGCCGAGTTCTCGGACCTGACTCCCTCCGCCGGACAGCCCCCT
TTGACTTCTGCGCCATCTGGCAAAGCTGGTAAAGCCGCCCGACGCAAGAACGCTGCGGAAGAGGCTGCTGCTGCT
GCTGCGGCGGCGGCGGCGGCGCTCTCGCTCACGCAGCAAGTGCAGAAGACGCAAGCGGCGGCGGCTGTCGAGCCG
GATATGCCAATGCCGTTCCCTCCGCCTTCTTCATCGACGCCTCTCCCGGCGCCGACGGCCCAGCGAGTCCGGTCT
AACCTCCCGGAGCAGTACAGCCGGTCGCAGAGCGGATCGCCCGAGGCGGTCCAGCCGCCGCCCATGGCGCCGTGG
GCTAAGGAGCCCGGGGTCGAGGGCCAGAAGGGTCCCAGCCTCAAGGAGATCCAGGAGGCCGAGACGCGCAAGGCG
GCCCGGGCCGAGGAAGCGGCGGCGGCGCTGCGCAAGGCATCGCTGGAGCAGGAGAACGCGCTGCTGCGAGAGAAG
GAGAGGCGGGCTTCGGCCTCGACGGCTGCCGGTCTCCCGCCTACCAGCACCTGGGGTCACGGATCGCCCGTCCTG
TCGTCGGGTCCGTGGTCGAAGCCCGGTCCGGCCAAGGGTCCAGCGCCCGGCTTGCAGAACGCGTCGACGACGGCG
ACGAGCAAGAAGACGCTGGCCGAGATCCAACGCGAGGAGGAGGTTCGCAAGCAAAAGTCACGCGACAGGGACGGC
GGTGCTCACCCCAGCGCCACGTCCGGCTCGTCCAAGAGCTACGCGAACTTGGCCGGGAAGCCCGGACAGACGGCG
GCGGCAGCAGCAGCGAACACGGCGGCGGCTGGAAGCGGCTGGGCCACGGTCGGGGCCGGAGGCAAGGTCAAGGCT
CCGACCGGACCGGCGGCCGTTCCGGGACGGGGAGGCAGCGCCAAGACGGCCGGATCCGTGGTCAAGGTGGTGTCG
AAGCCGGCGGCCAATAACAACAGCAGCAACAACAACACCAATGCCGGCGCCAACGGTAGAACCGAGTCGACGAGC
GCAGCCATGGAGGAGTTTAGCAAGTGGACGCGTCGCGAACTATCGCGAGGTCTCACCAACGTGACCGACATCTCG
GAGTTCCAAGCAGACCTGGACGCCCTCCCGCTCGATACGGGCGTCATCGCCGACGCCGTCTACATCAACTCCAAG
ACGATGGACGGACGACACTTTGCCGAGGAGTACGTGCGCCGCAAGAAGCTGGCAGAAAAGGGCATCGCCGAGAAG
CAGCAACTCCCCGTCGACAGCGGCAAGTCGGGCGCGGGCTGGTCCGAGGTAGCCAAGCGCAGCGGCGGCGGCGCT
CAGACCAAGGACGGTGATGCCGGCGGCGTGGGCTTCAAGGTGGTGCCCAACCGCAAGAAGGGCAAGAAATGA
Transcript >Ophun1|4402
ATGCGAATCGTGACGCACGAGGTGCCAGGGGAGACGGGAGGGGAGCTGCTGGAGGAGATTGCTAATGGAACTCTG
ACCTTCCGACGGTCATCGACAACCCCCACCGGCCATGCTCCGAATCCCTCTCCCTCTCACGACCACGCCGTTCAG
CCTCCCAGCGTTGAAGAATCGCCCCAGGCTACGTCCGCGCATGAGCCCGGCCCCTCGCGCTACACCAAGGACGAG
CTTCTCGACATGTTTCGCTCTCAAAAGCCCACTGACGATCCGTCGCACCTGTTCATGTCTGGATGGAACCCTGCT
AGCATCAATGGTAGCAGTGCGAGGTCCTGGGGCAGGACCAGCGACAGTCCCGTCCCGCAAGAGCCCGGCGCTTGC
TGGGACTCCAGCGGCGTCACCACTCCCATGGGCTTACAGGGCTTTTCGCTTGAGGAAAAAGAGGTAGGCTGGAGC
ACCAGGCTGCTCTACGCAGGCTCAGCTCACATACATCGCCAGGCCTTTTCCGCCGACATCAATTCGCCCTTGAAA
CCTCCTACCCAGAAAGGGGACGGTCATCAGGGCATCATCAACGGCAGAAAATCCTCCGTGTCCCACGGCACCGGC
AATGCCTTTGGCGTGGGCTCCCCTGCCTCTACCTCGCGTCAGGGAACGAGACGCCGTGAGACTATGGAGTCGAAT
CCTTTTGGCGGTGGCGGTCTCGTCTCACCCACGACCGCCAGCTCGAGCCGCTTCTCGCGTGATGAGTCTTCGCCA
TGGCCGGCGCGCAAATCCAACGATCTCAAGGAATCGGAGCCCGACGAGGCTGACGCAGACCATGGCCCTCGTGAC
GCCTCGGCCAAGTCTTCGGCCGGCAGCCTCCCTCGAATCGGCACCTCGGTTGGTGGCACCGGCGTCAGTGCAATC
TGGCCTCCGCAGGGCCAGATTACGCCCGGTGTAGGCGGCTTCGGTAACTTTGCTCTGCCTCACTCTTCCGTTGTC
GGCGACAAGCGCGTCGGTGGCGGCGTCGGTGGCGGTGGCAGCCGACTCGCCCACCTCATTCCCAAGGAAAGCCAC
GACAACTCGTCCAAAGCCGGAGACGGCCAGCAGTCATTCTGGCGCTCCCGTCCGCGGACCGACACGGACCCCTTT
GGCGGCGACGAGGAACTGTCGGGGAGCGCTGTCCTCGGCGGTTCCCAGGATATCACCGTCGGGGGACACGCGCAC
GTCGGCCGGGTTGGCGTCTTGGGAACGCCCATCAAGGCGTCGACCGGAGAGTTTGGCATGTCGGGCCTGGCCATC
GCTGGTCAGATGGGTGACAATGGCCCCGTCAGTCCGTCGGAGACCAACCCCTACCGCAGCCCTCCGGCCGAGCGT
CACGATGTCGACGACGGTGACGGTGCCGGCGTCGAGCGGGCCCATGCGGCCAACCAGCACGAGCAGCACGCCAAC
TTCGCCTCCGCCGCTCGAGGCTTTGGTGCGGCGGCCTTTGAGGGCAGTGATCGTAGCCAGACCTCTAGCGTGGGT
CCCAAGGGATACTCTCTCAGCGGCCTGTCTGGCTGGCCAGCTCCTGGCGTCCCCTCGGCCGGCACGCCCGATCGC
GAGCGCCAGGGTTTCGGAAACGCCTTTGGCAGTTCCCTCTTCAGCCCGGTCGGCGATCTCCAGTCTCCCGGACTC
TCCAACCTGAGCAACGTCGTCTTTGGGCCTGGTAACATTAGTCGCGGAAGCAAGCTCGGCTCCCTCTTCCCTCCC
GTCATGCAAGCACAGATGCAGTCCCACGAGCCCGACCACGGCCTATCCGACTCCGCCCCGGACCCGCGGCAGACC
AATCCGCTCGGGGCCATCGGTCGGGGAAGCATAGCCGGCCCTTCGCGGGACACGGAGAGTCCGATGCGATCGGCT
CGCGGCATGTTCGAGGATCTCTTCCCGTCCAGCGACGTCGGGAGGTCGCACGGGGCCTTTCACGCCATGGAGGCG
ACGCAGCCGACGGGCGCCGCGCCGGGTTCTCAGTCGTTTACGCCAGTCAGTGGCGAGATGGCTTTCGGCCCTCAG
TCCGGAAACGAGCCCCCCGTCTCTCAGGTCCGTCAGATGGTGATGCCGGATCGGATGAGATGGGTCTACCTCGAT
CCTCAGGGTCAGGTCCAGGGCCCGTTTACTGGGCTCGAGATGAACGACTGGTACAAGGCCAACTTCTTCACGCCC
GACCTCCGAGTCAAAAAGGTCGAGGATCCCGAGTTCGAGCCCCTGGGTCAGCTCATCAGGCGCATCGGTAACTCC
AGAGAACCGTTTCTTGTGCCCCAGATCGGGATCCCCCACGGGCCACCGTCACAGAGCGGACCCTTCACCTCGTCG
ACCAACGGCGGCGGCGTCGTGCCTCCTCTCAGCGGCGTCTTCCCCAGCTTTGGGAGGACGTTGACAGCCGAAGAG
CAGAACAATCTGGAACGGCGCAAACAGGAGGAACAGTACCTCATGGCCCAACAGAGGGAGTTTATGTTGCGACAG
CAGGCCATGACCAAGTTTCAGATACAGGGAGGGCCCGGCTTGCAACATCACTCCAGCGTCCACAGCCTTCAGAGC
CAGCCCAGTTTCGGCAGCATGGCTTCGCCGATCGGGGTCGCGCCGCCGCCGCTTCCACCTCCGCAGCAGCAACAG
CAGCAACAGCACCAGCCGCACCAGCCGCAGCACCAACCGCAGCAGGCACCACCGCCCATAGGCTCGATGCCCCTC
GGAATCTTCTCTGATCATGGTGCGGGCGGTCAGCCAGCCATGCGTGTCGCTCCGGGAGGCACCGAGTTGCTGAGG
ACGGACGATTTGGCGAGCCTCGGTTTGACGGAGCGTCAGGTCTTGGGCTCCTTGCAGGGCGATGAGTTGGGAGCA
CAGCAGCACGAGCGAGCCACGCAGGGTGACTCGGGCATGAGATCGGGACTGCCCGAGATGAGCCAGCTTGCAGAT
GACCCGGAAGGCTTCAGAGAGCGCTTCCAAGAGTTTGAGACGCTGCGGGCCCAGCACGAAGAGGAAACGGCGAGT
GATAGCAAGGCCACCGAAACCCCGTCTCCTTCGGCCGAGTTCTCGGACCTGACTCCCTCCGCCGGACAGCCCCCT
TTGACTTCTGCGCCATCTGGCAAAGCTGGTAAAGCCGCCCGACGCAAGAACGCTGCGGAAGAGGCTGCTGCTGCT
GCTGCGGCGGCGGCGGCGGCGCTCTCGCTCACGCAGCAAGTGCAGAAGACGCAAGCGGCGGCGGCTGTCGAGCCG
GATATGCCAATGCCGTTCCCTCCGCCTTCTTCATCGACGCCTCTCCCGGCGCCGACGGCCCAGCGAGTCCGGTCT
AACCTCCCGGAGCAGTACAGCCGGTCGCAGAGCGGATCGCCCGAGGCGGTCCAGCCGCCGCCCATGGCGCCGTGG
GCTAAGGAGCCCGGGGTCGAGGGCCAGAAGGGTCCCAGCCTCAAGGAGATCCAGGAGGCCGAGACGCGCAAGGCG
GCCCGGGCCGAGGAAGCGGCGGCGGCGCTGCGCAAGGCATCGCTGGAGCAGGAGAACGCGCTGCTGCGAGAGAAG
GAGAGGCGGGCTTCGGCCTCGACGGCTGCCGGTCTCCCGCCTACCAGCACCTGGGGTCACGGATCGCCCGTCCTG
TCGTCGGGTCCGTGGTCGAAGCCCGGTCCGGCCAAGGGTCCAGCGCCCGGCTTGCAGAACGCGTCGACGACGGCG
ACGAGCAAGAAGACGCTGGCCGAGATCCAACGCGAGGAGGAGGTTCGCAAGCAAAAGTCACGCGACAGGGACGGC
GGTGCTCACCCCAGCGCCACGTCCGGCTCGTCCAAGAGCTACGCGAACTTGGCCGGGAAGCCCGGACAGACGGCG
GCGGCAGCAGCAGCGAACACGGCGGCGGCTGGAAGCGGCTGGGCCACGGTCGGGGCCGGAGGCAAGGTCAAGGCT
CCGACCGGACCGGCGGCCGTTCCGGGACGGGGAGGCAGCGCCAAGACGGCCGGATCCGTGGTCAAGGTGGTGTCG
AAGCCGGCGGCCAATAACAACAGCAGCAACAACAACACCAATGCCGGCGCCAACGGTAGAACCGAGTCGACGAGC
GCAGCCATGGAGGAGTTTAGCAAGTGGACGCGTCGCGAACTATCGCGAGGTCTCACCAACGTGACCGACATCTCG
GAGTTCCAAGCAGACCTGGACGCCCTCCCGCTCGATACGGGCGTCATCGCCGACGCCGTCTACATCAACTCCAAG
ACGATGGACGGACGACACTTTGCCGAGGAGTACGTGCGCCGCAAGAAGCTGGCAGAAAAGGGCATCGCCGAGAAG
CAGCAACTCCCCGTCGACAGCGGCAAGTCGGGCGCGGGCTGGTCCGAGGTAGCCAAGCGCAGCGGCGGCGGCGCT
CAGACCAAGGACGGTGATGCCGGCGGCGTGGGCTTCAAGGTGGTGCCCAACCGCAAGAAGGGCAAGAAATGA
Gene >Ophun1|4402
ATGCGAATCGTGACGCACGAGGTGCCAGGGGAGACGGGAGGGGAGCTGCTGGAGGAGATTGGTGAGTTTTGCTGT
TGCTTTTTTTCCCTCGTCCTCGCTACTTGGCTGTTTCTCTTCTCCATCCACACTTTTTCCCCTCGTCTCCGTCTT
CTTTCGTCGTGCTCCACGCAAACTCGTGTTGGATAGACAGCTTCGGGGGCATACCTACATGGCTGGCTGCTTTTA
GACCAGGGTTGCTCCAGCAGGCGTCAGCCTCATCCGCCACAAGCCAACCAGTCACTAACTTGGCCACTTTTTTCC
ACAGGTCTCGACGGGATGGTCGTCCAGCTAATGGAACTCTGACCTTCCGACGGTCATCGACAACCCCCACCGGCC
ATGCTCCGAATCCCTCTCCCTCTCACGACCACGCCGTTCAGCCTCCCAGCGTTGAAGAATCGCCCCAGGCTACGT
CCGCGCATGAGCCCGGCCCCTCGCGCTACACCAAGGACGAGCTTCTCGACATGTTTCGCTCTCAAAAGCCCACTG
ACGATCCGTCGCACCTGTTCATGTCTGGATGGAACCCTGCTAGCATCAATGGTAGCAGTGCGAGGTCCTGGGGCA
GGACCAGCGACAGTCCCGTCCCGCAAGAGCCCGGCGCTTGCTGGGACTCCAGCGGCGTCACCACTCCCATGGGCT
TACAGGGCTTTTCGCTTGAGGAAAAAGAGGTAGGCTGGAGCACCAGGCTGCTCTACGCAGGCTCAGCTCACATAC
ATCGCCAGGCCTTTTCCGCCGACATCAATTCGCCCTTGAAACCTCCTACCCAGAAAGGGGACGGTCATCAGGGCA
TCATCAACGGCAGAAAATCCTCCGTGTCCCACGGCACCGGCAATGCCTTTGGCGTGGGCTCCCCTGCCTCTACCT
CGCGTCAGGGAACGAGACGCCGTGAGACTATGGAGTCGAATCCTTTTGGCGGTGGCGGTCTCGTCTCACCCACGA
CCGCCAGCTCGAGCCGCTTCTCGCGTGATGAGTCTTCGCCATGGCCGGCGCGCAAATCCAACGATCTCAAGGAAT
CGGAGCCCGACGAGGCTGACGCAGACCATGGCCCTCGTGACGCCTCGGCCAAGTCTTCGGCCGGCAGCCTCCCTC
GAATCGGCACCTCGGTTGGTGGCACCGGCGTCAGTGCAATCTGGCCTCCGCAGGGCCAGATTACGCCCGGTGTAG
GCGGCTTCGGTAACTTTGCTCTGCCTCACTCTTCCGTTGTCGGCGACAAGCGCGTCGGTGGCGGCGTCGGTGGCG
GTGGCAGCCGACTCGCCCACCTCATTCCCAAGGAAAGCCACGACAACTCGTCCAAAGCCGGAGACGGCCAGCAGT
CATTCTGGCGCTCCCGTCCGCGGACCGACACGGACCCCTTTGGCGGCGACGAGGAACTGTCGGGGAGCGCTGTCC
TCGGCGGTTCCCAGGATATCACCGTCGGGGGACACGCGCACGTCGGCCGGGTTGGCGTCTTGGGAACGCCCATCA
AGGCGTCGACCGGAGAGTTTGGCATGTCGGGCCTGGCCATCGCTGGTCAGATGGGTGACAATGGCCCCGTCAGTC
CGTCGGAGACCAACCCCTACCGCAGCCCTCCGGCCGAGCGTCACGATGTCGACGACGGTGACGGTGCCGGCGTCG
AGCGGGCCCATGCGGCCAACCAGCACGAGCAGCACGCCAACTTCGCCTCCGCCGCTCGAGGCTTTGGTGCGGCGG
CCTTTGAGGGCAGTGATCGTAGCCAGACCTCTAGCGTGGGTCCCAAGGGATACTCTCTCAGCGGCCTGTCTGGCT
GGCCAGCTCCTGGCGTCCCCTCGGCCGGCACGCCCGATCGCGAGCGCCAGGGTTTCGGAAACGCCTTTGGCAGTT
CCCTCTTCAGCCCGGTCGGCGATCTCCAGTCTCCCGGACTCTCCAACCTGAGCAACGTCGTCTTTGGGCCTGGTA
ACATTAGTCGCGGAAGCAAGCTCGGCTCCCTCTTCCCTCCCGTCATGCAAGCACAGATGCAGTCCCACGAGCCCG
ACCACGGCCTATCCGACTCCGCCCCGGACCCGCGGCAGACCAATCCGCTCGGGGCCATCGGTCGGGGAAGCATAG
CCGGCCCTTCGCGGGACACGGAGAGTCCGATGCGATCGGCTCGCGGCATGTTCGAGGATCTCTTCCCGTCCAGCG
ACGTCGGGAGGTCGCACGGGGCCTTTCACGCCATGGAGGCGACGCAGCCGACGGGCGCCGCGCCGGGTTCTCAGT
CGTTTACGCCAGTCAGTGGCGAGATGGCTTTCGGCCCTCAGTCCGGAAACGAGCCCCCCGTCTCTCAGGTCCGTC
AGATGGTGATGCCGGATCGGATGAGATGGGTCTACCTCGATCCTCAGGGTCAGGTCCAGGGCCCGTTTACTGGGC
TCGAGATGAACGACTGGTACAAGGCCAACTTCTTCACGCCCGACCTCCGAGTCAAAAAGGTCGAGGATCCCGAGT
TCGAGCCCCTGGGTCAGCTCATCAGGCGCATCGGTAACTCCAGAGAACCGTTTCTTGTGCCCCAGATCGGGATCC
CCCACGGGCCACCGTCACAGAGCGGACCCTTCACCTCGTCGACCAACGGCGGCGGCGTCGTGCCTCCTCTCAGCG
GCGTCTTCCCCAGCTTTGGGAGGACGTTGACAGCCGAAGAGCAGAACAATCTGGAACGGCGCAAACAGGAGGAAC
AGTACCTCATGGCCCAACAGAGGGAGTTTATGTTGCGACAGCAGGCCATGACCAAGTTTCAGATACAGGGAGGGC
CCGGCTTGCAACATCACTCCAGCGTCCACAGCCTTCAGAGCCAGCCCAGTTTCGGCAGCATGGCTTCGCCGATCG
GGGTCGCGCCGCCGCCGCTTCCACCTCCGCAGCAGCAACAGCAGCAACAGCACCAGCCGCACCAGCCGCAGCACC
AACCGCAGCAGGCACCACCGCCCATAGGCTCGATGCCCCTCGGAATCTTCTCTGATCATGGTGCGGGCGGTCAGC
CAGCCATGCGTGTCGCTCCGGGAGGCACCGAGTTGCTGAGGACGGACGATTTGGCGAGCCTCGGTTTGACGGAGC
GTCAGGTCTTGGGCTCCTTGCAGGGCGATGAGTTGGGAGCACAGCAGCACGAGCGAGCCACGCAGGGTGACTCGG
GCATGAGATCGGGACTGCCCGAGATGAGCCAGCTTGCAGATGACCCGGAAGGCTTCAGAGAGCGCTTCCAAGAGT
TTGAGACGCTGCGGGCCCAGCACGAAGAGGAAACGGCGAGTGATAGCAAGGCCACCGAAACCCCGTCTCCTTCGG
CCGAGTTCTCGGACCTGACTCCCTCCGCCGGACAGCCCCCTTTGACTTCTGCGCCATCTGGCAAAGCTGGTAAAG
CCGCCCGACGCAAGAACGCTGCGGAAGAGGCTGCTGCTGCTGCTGCGGCGGCGGCGGCGGCGCTCTCGCTCACGC
AGCAAGTGCAGAAGACGCAAGCGGCGGCGGCTGTCGAGCCGGATATGCCAATGCCGTTCCCTCCGCCTTCTTCAT
CGACGCCTCTCCCGGCGCCGACGGCCCAGCGAGTCCGGTCTAACCTCCCGGAGCAGTACAGCCGGTCGCAGAGCG
GATCGCCCGAGGCGGTCCAGCCGCCGCCCATGGCGCCGTGGGCTAAGGAGCCCGGGGTCGAGGGCCAGAAGGGTC
CCAGCCTCAAGGAGATCCAGGAGGCCGAGACGCGCAAGGCGGCCCGGGCCGAGGAAGCGGCGGCGGCGCTGCGCA
AGGCATCGCTGGAGCAGGAGAACGCGCTGCTGCGAGAGAAGGAGAGGCGGGCTTCGGCCTCGACGGCTGCCGGTC
TCCCGCCTACCAGCACCTGGGGTCACGGATCGCCCGTCCTGTCGTCGGGTCCGTGGTCGAAGCCCGGTCCGGCCA
AGGGTCCAGCGCCCGGCTTGCAGAACGCGTCGACGACGGCGACGAGCAAGAAGACGCTGGCCGAGATCCAACGCG
AGGAGGAGGTTCGCAAGCAAAAGTCACGCGACAGGGACGGCGGTGCTCACCCCAGCGCCACGTCCGGCTCGTCCA
AGAGCTACGCGAACTTGGCCGGGAAGCCCGGACAGACGGCGGCGGCAGCAGCAGCGAACACGGCGGCGGCTGGAA
GCGGCTGGGCCACGGTCGGGGCCGGAGGCAAGGTCAAGGCTCCGACCGGACCGGCGGCCGTTCCGGGACGGGGAG
GCAGCGCCAAGACGGCCGGATCCGTGGTCAAGGTGGTGTCGAAGCCGGCGGCCAATAACAACAGCAGCAACAACA
ACACCAATGCCGGCGCCAACGGTAGAACCGAGTCGACGAGCGCAGCCATGGAGGAGTTTAGCAAGTGGACGCGTC
GCGAACTATCGCGAGGTCTCACCAACGTGACCGACAGTGAGTCTCTCTTCACTTCCCCCCCCCTCCCCCTTCTTG
TCCTCCTCTTCTAACATGGACTTCTCAGTCTCGGAGTTCCAAGCAGACCTGGACGCCCTCCCGCTCGATACGGGC
GTCATCGCCGACGCCGTCTACATCAACTCCAAGACGATGGACGGACGACACTTTGCCGAGGAGTACGTGCGCCGC
AAGAAGCTGGCAGAAAAGGGCATCGCCGAGAAGCAGCAACTCCCCGTCGACAGCGGCAAGTCGGGCGCGGGCTGG
TCCGAGGTAGCCAAGCGCAGCGGCGGCGGCGCTCAGACCAAGGACGGTGATGCCGGCGGCGTGGGCTTCAAGGTG
GTGCCCAACCGCAAGAAGGGCAAGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail