Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4395
Gene name
LocationContig_403:10379..12118
Strand-
Gene length (bp)1739
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.0E-06 40 103
PF00743 FMO-like Flavin-binding monooxygenase-like 4.7E-05 38 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 34 515 9.0E-73
sp|Q9I3H5|BVMO_PSEAE Baeyer-Villiger monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1538 PE=1 SV=1 34 493 7.0E-69
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 38 497 9.0E-68
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 38 497 9.0E-68
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 38 497 9.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 34 515 9.0E-73
sp|Q9I3H5|BVMO_PSEAE Baeyer-Villiger monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1538 PE=1 SV=1 34 493 7.0E-69
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 38 497 9.0E-68
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 38 497 9.0E-68
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 38 497 9.0E-68
sp|P55487|Y4ID_RHISN Uncharacterized monooxygenase y4iD OS=Rhizobium sp. (strain NGR234) GN=NGR_a03290 PE=3 SV=1 39 485 8.0E-61
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 36 519 4.0E-60
sp|Q00730|STCW_EMENI Putative sterigmatocystin biosynthesis monooxygenase stcW OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcW PE=3 SV=2 29 495 4.0E-49
sp|P12015|CHMO_ACISP Cyclohexanone 1,2-monooxygenase OS=Acinetobacter sp. PE=1 SV=2 39 474 8.0E-46
sp|H3JQW0|OTEMO_PSEPU 2-oxo-Delta(3)-4,5,5-trimethylcyclopentenylacetyl-CoA monooxygenase OS=Pseudomonas putida GN=otemo PE=1 SV=1 39 500 5.0E-45
sp|A3U3H1|BVMO_OCEBH Baeyer-Villiger monooxygenase OS=Oceanicola batsensis (strain ATCC BAA-863 / DSM 15984 / HTCC2597) GN=OB2597_18631 PE=1 SV=1 39 471 1.0E-41
sp|A7HU16|BVMO_PARL1 Baeyer-Villiger monooxygenase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=Plav_1781 PE=1 SV=1 40 509 7.0E-41
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 39 494 2.0E-35
sp|U5S003|BVMO4_DIESD Baeyer-Villiger monooxygenase 4 OS=Dietzia sp. (strain D5) PE=1 SV=1 57 516 2.0E-35
sp|E3VWK3|PENE_STREX Pentalenolactone D synthase OS=Streptomyces exfoliatus GN=penE PE=1 SV=1 38 515 1.0E-34
sp|E3VWI7|PNTE_STRAE Pentalenolactone D synthase OS=Streptomyces arenae GN=pntE PE=1 SV=1 38 515 2.0E-33
sp|A1CLY7|CCSB_ASPCL Ketocytochalasin monooxygenase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsB PE=1 SV=1 7 427 1.0E-30
sp|Q88J44|BVMO_PSEPK Baeyer-Villiger monooxygenase OS=Pseudomonas putida (strain KT2440) GN=PP_2805 PE=1 SV=1 40 426 3.0E-30
sp|P9WNF9|ETHA_MYCTU FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ethA PE=1 SV=1 32 426 6.0E-29
sp|P9WNF8|ETHA_MYCTO FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ethA PE=3 SV=1 32 426 6.0E-29
sp|Q7TVI2|ETHA_MYCBO FAD-containing monooxygenase EthA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ethA PE=1 SV=1 32 426 6.0E-29
sp|P9WNF7|MYMA_MYCTU Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mymA PE=1 SV=1 40 457 7.0E-28
sp|P9WNF6|MYMA_MYCTO Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mymA PE=3 SV=1 40 457 7.0E-28
sp|A0R665|ETHA_MYCS2 FAD-containing monooxygenase EthA OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ethA PE=3 SV=1 32 426 4.0E-25
sp|Q82IY8|PTLE_STRAW Neopentalenolactone D synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlE PE=1 SV=1 62 497 1.0E-24
sp|Q9RL17|BVMO1_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0300 PE=1 SV=1 55 239 2.0E-18
sp|Q8GAW0|CPMO_COMS9 Cyclopentanone 1,2-monooxygenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnB PE=1 SV=3 39 509 4.0E-18
sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 35 262 6.0E-09
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 40 269 7.0E-09
sp|Q9LMA1|FMO1_ARATH Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana GN=FMO1 PE=2 SV=1 33 378 4.0E-08
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 40 269 2.0E-07
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 40 239 2.0E-07
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 40 239 3.0E-07
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 40 239 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0005488 binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0000166 nucleotide binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0003674 molecular_function No
GO:0004497 monooxygenase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 541 558 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4395
MAQPLSQPVARPELRDYHDEEDDYNDDKDGNTTYSQFACIGVGFSGIALGATLKRWHNIQDVRFFERRPDIGGTW
SANRYPGCAVDIPGFLYSFSFAPNPDWTGILPAADEIRAYLRRVADRYGVTARTSFGAHVIACHWRSRSRRWRLV
VRYPDDGGRIVRHDCRFLFGATGVLVHPKDPGLVGLDSFRGRCFHTASWPADLDLSDKRVVVVGNGCTASQVIPA
IIGQCRHLSQFIRSRQWFLQSPPSFTIPPSVHWLLAHVPGLLSFLRLVVFFVHELHGRVYPMTAAGHRRRAAEAS
ATLSFVRSTAPAQFHAMLEPDYAPGCKRRVLGTDYVRSLNAPNISVTEEPIVEVLPDGVRSRDGAFTPADVIILA
SGFLTGRFMHGIDVRGSDGRTLDQHWKQYGGAEAYNCCALSHFPNMFMLLGPNTITGHTSCVMAIENGVNYALRV
IRPILDSPDAFVEVKPEAEARYSRDLQQALGKTVYLSGCISWYNQEGPDGRKWNSISYPRSQAEFWYRCLFPVRR
DWNYVGAPHATSRSKPTLLAVAAAVLGALWLLWRNRGP*
Coding >Ophun1|4395
ATGGCACAACCTCTATCCCAGCCCGTGGCCCGACCGGAACTGCGCGACTACCATGACGAAGAAGACGACTACAAC
GACGACAAGGACGGAAACACGACTTACAGCCAGTTCGCCTGCATCGGCGTCGGCTTCTCCGGCATCGCCCTGGGC
GCAACCCTCAAACGCTGGCACAACATCCAAGACGTGCGCTTCTTCGAGCGTCGCCCCGACATCGGAGGCACCTGG
TCCGCCAACCGCTATCCCGGCTGCGCCGTCGACATCCCCGGCTTCCTCTACAGCTTCTCCTTCGCCCCTAATCCG
GACTGGACGGGCATCCTTCCGGCCGCCGACGAGATCCGCGCCTACCTGCGTCGAGTGGCGGACCGGTACGGTGTC
ACGGCTCGGACCTCATTCGGCGCCCATGTCATTGCCTGTCACTGGAGGTCACGCTCGCGGCGGTGGAGGCTCGTC
GTTCGATATCCTGATGATGGGGGTCGTATCGTCCGGCACGACTGTCGCTTTCTCTTTGGCGCCACTGGCGTCCTC
GTCCATCCCAAGGATCCGGGCCTCGTTGGCCTCGACTCGTTCCGTGGTCGCTGCTTTCACACCGCCAGCTGGCCG
GCCGACTTGGACCTGTCCGACAAGCGAGTCGTCGTCGTCGGCAACGGCTGTACTGCCTCTCAAGTGATACCCGCC
ATCATCGGCCAATGCCGCCATCTCTCGCAGTTCATCCGCTCGCGCCAGTGGTTCCTCCAGTCGCCTCCCAGCTTC
ACCATCCCGCCTTCAGTTCACTGGCTCCTGGCCCACGTGCCGGGTCTGTTGTCCTTTCTTCGCCTTGTCGTCTTC
TTCGTCCACGAGCTGCACGGACGGGTTTACCCCATGACGGCTGCCGGTCACCGGCGTCGAGCCGCCGAAGCCTCC
GCCACTCTCTCCTTCGTCCGCTCCACGGCTCCGGCCCAGTTTCACGCCATGCTCGAGCCCGACTATGCCCCCGGC
TGTAAGCGTCGTGTCCTGGGCACCGACTACGTGCGGTCTCTCAACGCGCCCAACATCAGCGTCACGGAAGAGCCC
ATCGTCGAGGTGCTTCCCGATGGCGTCCGCTCCCGTGACGGCGCCTTCACGCCCGCAGACGTCATTATCCTCGCC
AGTGGCTTCTTGACCGGCCGCTTCATGCACGGCATCGACGTCAGGGGCAGTGACGGTCGCACCCTCGATCAGCAC
TGGAAACAGTATGGTGGTGCAGAGGCTTACAACTGCTGCGCCCTGAGTCACTTCCCCAACATGTTCATGCTCCTC
GGGCCCAACACCATCACCGGACACACCTCATGCGTCATGGCCATCGAGAACGGCGTCAACTACGCGCTCCGCGTC
ATCCGCCCCATCCTCGACAGCCCAGACGCCTTCGTAGAGGTCAAGCCCGAAGCCGAGGCCCGCTACTCGCGCGAC
TTGCAGCAGGCCCTGGGAAAGACCGTCTACCTCTCCGGCTGCATCAGCTGGTACAACCAGGAGGGCCCAGACGGC
CGCAAGTGGAATTCCATATCTTATCCCCGCTCCCAGGCCGAGTTTTGGTATCGCTGCCTGTTCCCCGTCCGTCGA
GACTGGAACTATGTCGGGGCGCCACATGCCACGTCACGCAGTAAACCTACGCTTTTGGCCGTGGCTGCCGCTGTT
CTTGGCGCCTTGTGGCTGCTGTGGAGGAACAGGGGACCCTGA
Transcript >Ophun1|4395
ATGGCACAACCTCTATCCCAGCCCGTGGCCCGACCGGAACTGCGCGACTACCATGACGAAGAAGACGACTACAAC
GACGACAAGGACGGAAACACGACTTACAGCCAGTTCGCCTGCATCGGCGTCGGCTTCTCCGGCATCGCCCTGGGC
GCAACCCTCAAACGCTGGCACAACATCCAAGACGTGCGCTTCTTCGAGCGTCGCCCCGACATCGGAGGCACCTGG
TCCGCCAACCGCTATCCCGGCTGCGCCGTCGACATCCCCGGCTTCCTCTACAGCTTCTCCTTCGCCCCTAATCCG
GACTGGACGGGCATCCTTCCGGCCGCCGACGAGATCCGCGCCTACCTGCGTCGAGTGGCGGACCGGTACGGTGTC
ACGGCTCGGACCTCATTCGGCGCCCATGTCATTGCCTGTCACTGGAGGTCACGCTCGCGGCGGTGGAGGCTCGTC
GTTCGATATCCTGATGATGGGGGTCGTATCGTCCGGCACGACTGTCGCTTTCTCTTTGGCGCCACTGGCGTCCTC
GTCCATCCCAAGGATCCGGGCCTCGTTGGCCTCGACTCGTTCCGTGGTCGCTGCTTTCACACCGCCAGCTGGCCG
GCCGACTTGGACCTGTCCGACAAGCGAGTCGTCGTCGTCGGCAACGGCTGTACTGCCTCTCAAGTGATACCCGCC
ATCATCGGCCAATGCCGCCATCTCTCGCAGTTCATCCGCTCGCGCCAGTGGTTCCTCCAGTCGCCTCCCAGCTTC
ACCATCCCGCCTTCAGTTCACTGGCTCCTGGCCCACGTGCCGGGTCTGTTGTCCTTTCTTCGCCTTGTCGTCTTC
TTCGTCCACGAGCTGCACGGACGGGTTTACCCCATGACGGCTGCCGGTCACCGGCGTCGAGCCGCCGAAGCCTCC
GCCACTCTCTCCTTCGTCCGCTCCACGGCTCCGGCCCAGTTTCACGCCATGCTCGAGCCCGACTATGCCCCCGGC
TGTAAGCGTCGTGTCCTGGGCACCGACTACGTGCGGTCTCTCAACGCGCCCAACATCAGCGTCACGGAAGAGCCC
ATCGTCGAGGTGCTTCCCGATGGCGTCCGCTCCCGTGACGGCGCCTTCACGCCCGCAGACGTCATTATCCTCGCC
AGTGGCTTCTTGACCGGCCGCTTCATGCACGGCATCGACGTCAGGGGCAGTGACGGTCGCACCCTCGATCAGCAC
TGGAAACAGTATGGTGGTGCAGAGGCTTACAACTGCTGCGCCCTGAGTCACTTCCCCAACATGTTCATGCTCCTC
GGGCCCAACACCATCACCGGACACACCTCATGCGTCATGGCCATCGAGAACGGCGTCAACTACGCGCTCCGCGTC
ATCCGCCCCATCCTCGACAGCCCAGACGCCTTCGTAGAGGTCAAGCCCGAAGCCGAGGCCCGCTACTCGCGCGAC
TTGCAGCAGGCCCTGGGAAAGACCGTCTACCTCTCCGGCTGCATCAGCTGGTACAACCAGGAGGGCCCAGACGGC
CGCAAGTGGAATTCCATATCTTATCCCCGCTCCCAGGCCGAGTTTTGGTATCGCTGCCTGTTCCCCGTCCGTCGA
GACTGGAACTATGTCGGGGCGCCACATGCCACGTCACGCAGTAAACCTACGCTTTTGGCCGTGGCTGCCGCTGTT
CTTGGCGCCTTGTGGCTGCTGTGGAGGAACAGGGGACCCTGA
Gene >Ophun1|4395
ATGGCACAACCTCTATCCCAGCCCGTGGCCCGACCGGAACTGCGCGACTACCATGACGAAGAAGACGACTACAAC
GACGACAAGGACGGAAACACGACTTACAGCCAGTTCGCCTGCATCGGCGTCGGCTTCTCCGGCATCGCCCTGGGC
GCAACCCTCAAACGCTGGCACAACATCCAAGACGTGCGCTTCTTCGAGCGTCGCCCCGACATCGGAGGCACCTGG
TCCGCCAACCGCTATCCCGGCTGCGCCGTCGACATCCCCGGCTTCCTCTACAGCTTCTCCTTCGCCCCTAATCCG
GACTGGACGGGCATCCTTCCGGCCGCCGACGAGATCCGCGCCTACCTGCGTCGAGTGGCGGACCGGTACGGTGTC
ACGGCTCGGACCTCATTCGGCGCCCATGTCATTGCCTGTCACTGGAGGTCACGCTCGCGGCGGTGGAGGCTCGTC
GTTCGATATCCTGATGATGGGGGTCGTATCGTCCGGCACGACTGTCGCTTTCTCTTTGGCGCCACTGGCGTCCTC
GTCCATCCCAAGGATCCGGGCCTCGTTGGCCTCGACTCGTTCCGTGGTCGCTGCTTTCACACCGCCAGCTGGCCG
GCCGACTTGGACCTGTCCGACAAGCGAGTCGTCGTCGTCGGCAACGGCTGTACTGCCTCTCAAGTGATACCCGCC
ATCATCGGCCAATGCCGCCATCTCTCGCAGTTCATCCGCTCGCGCCAGTGGTTCCTCCAGTCGCCTCCCAGCTTC
ACCATCCCGCCTTCAGTTCACTGGCTCCTGGCCCACGTGCCGGGTCTGTTGTCCTTTCTTCGCCTTGTCGTCTTC
TTCGTCCACGAGCTGCACGGACGGGTTTACCCCATGACGGCTGCCGGTCACCGGCGTCGAGCCGCCGAAGCCTCC
GCCACTCTCTCCTTCGTCCGCTCCACGGCTCCGGCCCAGTTTCACGCCATGCTCGAGCCCGACTATGCCCCCGGC
TGTAAGCGTCGTGTCCTGGGCACCGACTACGTGCGGTCTCTCAACGCGCCCAACATCAGCGTCACGGAAGAGCCC
ATCGTCGAGGTGCTTCCCGATGGCGTCCGCTCCCGTGACGGCGCCTTCACGCCCGCAGACGTCATTATCCTCGCC
AGTGGCTTCTTGACCGGCCGCTTCATGCACGGCATCGACGTCAGGGGCAGTGACGGTCGCACCCTCGATCAGCAC
TGGAAACAGTATGGTGGTGCAGAGGCTTACAACTGCTGCGCCCTGAGTCACTTCCCCAACATGTTCATGCTCCTC
GGGCCCAACACCATCACCGGACACACCTCATGCGTCATGGCCATCGAGAACGGCGTCAACTACGCGCTCCGCGTC
ATCCGCCCCATCCTCGACAGCCCAGACGCCTTCGTAGAGGTCAAGCCCGAAGCCGAGGCCCGCTACTCGCGCGAC
TTGCAGCAGGCCCTGGGAAAGACCGTCTACCTCTCCGGCTGCATCAGCTGGTACAACCAGGAGGGCCCAGACGGC
CGCAAGTGGAATTCCATATCTTATCCCCGCTCCCAGGCCGAGTTTTGGTATCGCTGCCTGTTCCCCGTCCGTCGA
GACTGGAACTATGTCGTACGTCGTCACAAACCTCATGGGGCCAACAAGCTAACGTCTCGCAGGGGGCGCCACATG
CCACGTCACGCAGTAAACCTACGCTTTTGGCCGTGGCTGCCGCTGTTCTTGGCGCCTTGTGGCTGCTGTGGAGGA
ACAGGGGACCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail