Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4393
Gene name
LocationContig_403:5610..8626
Strand-
Gene length (bp)3016
Transcript length (bp)2832
Coding sequence length (bp)2832
Protein length (aa) 944

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01602 Adaptin_N Adaptin N terminal region 1.2E-115 22 555
PF08752 COP-gamma_platf Coatomer gamma subunit appendage platform subdomain 1.2E-55 673 821
PF16381 Coatomer_g_Cpla Coatomer subunit gamma-1 C-terminal appendage platform 3.8E-30 824 942
PF13646 HEAT_2 HEAT repeats 1.1E-11 453 552

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9QZE5|COPG1_MOUSE Coatomer subunit gamma-1 OS=Mus musculus GN=Copg1 PE=1 SV=1 3 943 0.0E+00
sp|Q7PVF6|COPG_ANOGA Coatomer subunit gamma OS=Anopheles gambiae GN=gammaCop PE=3 SV=2 17 943 0.0E+00
sp|D4ABY2|COPG2_RAT Coatomer subunit gamma-2 OS=Rattus norvegicus GN=Copg2 PE=3 SV=2 3 770 0.0E+00
sp|Q22498|COPG_CAEEL Probable coatomer subunit gamma OS=Caenorhabditis elegans GN=T14G10.5 PE=3 SV=1 1 942 0.0E+00
sp|Q29AE5|COPG_DROPS Coatomer subunit gamma OS=Drosophila pseudoobscura pseudoobscura GN=gammaCop PE=3 SV=1 2 943 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9QZE5|COPG1_MOUSE Coatomer subunit gamma-1 OS=Mus musculus GN=Copg1 PE=1 SV=1 3 943 0.0E+00
sp|Q7PVF6|COPG_ANOGA Coatomer subunit gamma OS=Anopheles gambiae GN=gammaCop PE=3 SV=2 17 943 0.0E+00
sp|D4ABY2|COPG2_RAT Coatomer subunit gamma-2 OS=Rattus norvegicus GN=Copg2 PE=3 SV=2 3 770 0.0E+00
sp|Q22498|COPG_CAEEL Probable coatomer subunit gamma OS=Caenorhabditis elegans GN=T14G10.5 PE=3 SV=1 1 942 0.0E+00
sp|Q29AE5|COPG_DROPS Coatomer subunit gamma OS=Drosophila pseudoobscura pseudoobscura GN=gammaCop PE=3 SV=1 2 943 0.0E+00
sp|P32074|COPG_YEAST Coatomer subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC21 PE=1 SV=2 18 931 0.0E+00
sp|Q8I0G5|COPG_DROME Coatomer subunit gamma OS=Drosophila melanogaster GN=gammaCOP PE=2 SV=1 16 943 0.0E+00
sp|Q54HL0|COPG_DICDI Coatomer subunit gamma OS=Dictyostelium discoideum GN=copG PE=1 SV=1 5 941 0.0E+00
sp|Q9Y678|COPG1_HUMAN Coatomer subunit gamma-1 OS=Homo sapiens GN=COPG1 PE=1 SV=1 3 943 0.0E+00
sp|Q4AEF8|COPG1_RAT Coatomer subunit gamma-1 OS=Rattus norvegicus GN=Copg1 PE=2 SV=1 3 943 0.0E+00
sp|P53620|COPG1_BOVIN Coatomer subunit gamma-1 OS=Bos taurus GN=COPG1 PE=1 SV=1 3 943 0.0E+00
sp|P87140|COPG_SCHPO Probable coatomer subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec21 PE=1 SV=1 1 943 0.0E+00
sp|Q8H852|COPG1_ORYSJ Coatomer subunit gamma-1 OS=Oryza sativa subsp. japonica GN=Os03g0227000 PE=2 SV=2 17 935 0.0E+00
sp|Q6DKD7|COPG2_XENLA Coatomer subunit gamma-2 OS=Xenopus laevis GN=copg2 PE=2 SV=1 3 943 0.0E+00
sp|Q9QXK3|COPG2_MOUSE Coatomer subunit gamma-2 OS=Mus musculus GN=Copg2 PE=1 SV=1 3 943 0.0E+00
sp|Q9UBF2|COPG2_HUMAN Coatomer subunit gamma-2 OS=Homo sapiens GN=COPG2 PE=1 SV=1 3 943 0.0E+00
sp|Q66JI9|COPG2_XENTR Coatomer subunit gamma-2 OS=Xenopus tropicalis GN=copg2 PE=2 SV=1 3 943 0.0E+00
sp|Q9PUE4|COPG2_DANRE Coatomer subunit gamma-2 OS=Danio rerio GN=copg2 PE=2 SV=2 3 943 0.0E+00
sp|A2VE21|COPG2_BOVIN Coatomer subunit gamma-2 OS=Bos taurus GN=COPG2 PE=2 SV=1 3 943 0.0E+00
sp|Q9I8E6|COPG2_TAKRU Coatomer subunit gamma-2 OS=Takifugu rubripes GN=copg2 PE=3 SV=1 3 943 0.0E+00
sp|Q6Z382|COPG2_ORYSJ Coatomer subunit gamma-2 OS=Oryza sativa subsp. japonica GN=Os07g0201100 PE=2 SV=1 5 935 0.0E+00
sp|Q0WW26|COPG_ARATH Coatomer subunit gamma OS=Arabidopsis thaliana GN=At4g34450 PE=1 SV=2 5 943 0.0E+00
[Show less]

GO

GO Term Description Terminal node
GO:0005198 structural molecule activity Yes
GO:0030126 COPI vesicle coat Yes
GO:0006886 intracellular protein transport Yes
GO:0030117 membrane coat Yes
GO:0016192 vesicle-mediated transport Yes
GO:0030120 vesicle coat No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0098796 membrane protein complex No
GO:0032991 protein-containing complex No
GO:0051649 establishment of localization in cell No
GO:0071705 nitrogen compound transport No
GO:0033036 macromolecule localization No
GO:0051179 localization No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0015031 protein transport No
GO:0003674 molecular_function No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0051641 cellular localization No
GO:0071702 organic substance transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4218
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6727
Ophiocordyceps australis map64 (Brazil) OphauB2|7436
Ophiocordyceps camponoti-floridani Ophcf2|06219
Ophiocordyceps camponoti-rufipedis Ophun1|4393 (this protein)
Ophiocordyceps kimflemingae Ophio5|4906
Ophiocordyceps subramaniannii Hirsu2|8610

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4393
MSYGKKDEDADLGLVKVDRTQVFQEARLFNSSPIQPRRCRILLTKIALLLYTGEKFPANEATTLFFGISKLFQNK
DASLRQMVHLIIKELASSAEDIIMVTSTIMKDTGGSSDAIFRPNAIRALCRIIDATTVQSIERVMKTAIVDKNPS
VSSAALVSSYHLLPIAKDVVRRWQSETQEAAASTKSSGGFSLGFSSSSGQMPMNNSTMTQYHAIGLLYQMRMHDR
MALVKMVQQFGAAGAVKNPAATVMLVRLAAQLAEEDASLRKPMMQLLDGWLRHKSEMVNFEAAKAICDLRDVSDA
EVAQAVHVLQLFLSSPRAVTKFAALRILHNFASFKPSAVAACNPDIELLISNSNRSIATFAITTLLKTGNEASVD
RLMKQISGFMSEITDEFKVTIVEAIRTLCLKFPSKQAGMLTFLSGILRDEGGYEFKRAVVESMFDLIKFVPDSKE
EALAHLCEFIEDCEFTKLAVRILHLIGLEGPKTTQPTKYIRYIYNRVVLENAIVRAAAVTALAKFGVGQKDPDVK
SSVRVLLTRCLDDVDDEVRDRAALNLKLMGDDKDDETAQNFVKNGKPFHHPRRILTTANTNFLENMFSLPIFEHQ
LVMYVTSDDKSAFDDPFDVTKIPVVTREQADAEDRTKKLTATAPTLKAPKVGPAAKAPSSGAEAAASASAQAQRY
AETLMRIPEMANFGHVLKSSPVVELTEAETEYVVTLVKHIFKEHIVLQYEVKNTLPDTVLENVSVVATPSEEEEL
EEEFIIPAERLVTNEPGSVYVAFKKVNGESALPVTSVSNILKFTSKEIDPTTNEPEETGYDDEYEVSEFDLAGSD
YLVPTFASNFNHLWEQIGASGEQAEETLQLSGMKSIAGEYHLATEQLARTLSLQPLDGTDVPINQSTHTLKLLGK
TVLGGRVVATVRMAYSSKSGVTTKIQVRSEEDNVAALVLTSVA*
Coding >Ophun1|4393
ATGAGCTACGGGAAAAAGGACGAGGATGCAGACCTGGGCCTGGTCAAGGTTGACCGCACGCAGGTCTTCCAGGAA
GCCCGCCTGTTCAACAGCTCGCCCATCCAGCCGCGACGATGTCGAATTCTGCTCACCAAGATCGCCCTTCTCCTC
TATACGGGGGAGAAGTTCCCGGCAAATGAGGCCACCACGCTCTTCTTCGGCATCTCCAAGCTCTTCCAGAATAAA
GATGCCAGTCTGCGACAGATGGTCCACCTCATCATCAAGGAGCTGGCCAGCTCGGCTGAGGACATCATCATGGTC
ACCAGCACCATCATGAAGGATACCGGCGGCAGCAGCGACGCCATCTTCCGCCCCAATGCCATCCGTGCCCTGTGT
CGCATCATCGATGCGACGACCGTGCAATCCATCGAGCGCGTCATGAAGACTGCCATCGTGGATAAGAACCCTTCG
GTGTCTTCCGCCGCCTTGGTCTCGTCCTACCACCTCCTGCCCATCGCAAAGGATGTCGTGCGCCGTTGGCAGAGC
GAGACGCAAGAGGCTGCAGCCTCCACCAAGTCTTCCGGCGGCTTCTCACTCGGCTTCTCCTCCTCGAGCGGCCAG
ATGCCCATGAACAACTCCACCATGACGCAGTATCACGCCATCGGCCTGCTGTACCAGATGCGGATGCACGACAGG
ATGGCTCTCGTCAAGATGGTCCAGCAGTTCGGCGCTGCCGGCGCGGTCAAAAACCCTGCCGCCACCGTCATGCTC
GTCCGTCTCGCGGCTCAGCTGGCCGAGGAGGACGCCTCGCTGCGGAAGCCCATGATGCAGCTCCTCGACGGCTGG
TTGCGTCACAAGAGCGAAATGGTCAACTTTGAGGCCGCAAAGGCCATCTGTGATCTGAGGGACGTGTCCGACGCC
GAGGTCGCACAGGCCGTTCACGTCTTGCAGCTCTTCCTGTCGTCGCCGCGGGCCGTCACCAAGTTCGCCGCCCTC
CGCATCCTGCACAACTTTGCCTCTTTCAAGCCCAGCGCCGTGGCCGCCTGCAACCCGGACATTGAGCTCCTCATC
TCCAACAGCAACAGGTCCATCGCCACATTCGCCATCACCACGCTTCTCAAGACGGGCAACGAGGCCAGCGTGGAT
CGGCTGATGAAGCAGATATCGGGTTTCATGTCGGAAATCACCGACGAGTTCAAGGTCACCATCGTCGAGGCCATC
CGCACTCTGTGCCTCAAGTTCCCGAGCAAGCAGGCCGGCATGTTGACCTTCCTCAGCGGCATCCTCCGCGACGAG
GGCGGTTACGAGTTCAAGCGCGCCGTCGTGGAGAGCATGTTTGACCTCATCAAGTTCGTGCCGGATTCCAAGGAA
GAGGCCCTGGCCCATCTCTGCGAATTCATCGAGGACTGCGAGTTCACCAAACTCGCCGTCCGTATACTGCACCTC
ATCGGCCTGGAGGGACCCAAGACGACCCAGCCGACCAAGTACATCCGCTACATCTACAACCGTGTGGTGCTGGAG
AACGCCATCGTTCGGGCCGCGGCCGTCACCGCTCTGGCCAAGTTCGGTGTCGGTCAGAAGGATCCCGATGTCAAG
TCGAGCGTCAGGGTGCTACTCACTCGGTGTCTCGACGACGTCGATGACGAGGTCCGCGATCGTGCCGCCTTGAAT
TTGAAGCTCATGGGCGACGACAAGGACGACGAGACGGCGCAGAACTTTGTCAAGAATGGCAAGCCTTTCCATCAT
CCCCGACGCATCCTCACGACGGCTAACACCAACTTCCTAGAAAACATGTTCTCCCTTCCCATCTTCGAGCATCAA
CTCGTCATGTACGTCACATCGGACGACAAGTCGGCCTTTGACGACCCCTTCGACGTGACCAAGATTCCCGTCGTC
ACCCGCGAGCAGGCCGACGCCGAGGACAGGACGAAGAAGCTGACGGCGACGGCTCCTACGCTCAAGGCGCCCAAG
GTCGGCCCGGCCGCCAAGGCTCCTTCGAGCGGCGCCGAGGCTGCTGCGTCGGCTTCGGCTCAGGCGCAACGCTAC
GCCGAGACGCTGATGCGGATCCCGGAGATGGCCAACTTTGGCCACGTGCTCAAGTCTTCGCCGGTGGTGGAATTG
ACAGAGGCCGAGACGGAGTACGTGGTGACGCTGGTCAAGCACATCTTCAAGGAGCACATCGTGCTCCAATACGAG
GTGAAGAACACGCTTCCAGACACGGTGCTGGAGAATGTGTCTGTCGTGGCCACTCCATCCGAGGAGGAGGAGCTC
GAGGAGGAGTTCATCATTCCAGCCGAACGGCTGGTGACCAACGAGCCGGGCAGCGTCTACGTGGCCTTTAAAAAG
GTCAATGGCGAGTCGGCGCTACCCGTCACGTCCGTGTCCAACATCCTCAAGTTCACCAGCAAGGAGATCGACCCG
ACGACCAACGAGCCGGAAGAGACGGGCTACGATGACGAGTACGAGGTGTCCGAGTTTGACCTCGCCGGCAGCGAC
TACCTGGTGCCGACGTTTGCCAGCAACTTTAACCACCTGTGGGAGCAGATCGGCGCCTCGGGCGAGCAGGCGGAG
GAGACGCTGCAGCTGAGCGGCATGAAGAGCATTGCAGGCGAGTACCACTTGGCGACGGAGCAGCTGGCGAGGACC
TTGTCGCTGCAGCCATTGGACGGCACCGACGTGCCCATCAACCAGAGCACCCACACGCTCAAGCTTCTGGGCAAG
ACAGTCCTCGGAGGCAGGGTGGTGGCCACGGTGCGGATGGCGTATTCGTCCAAGTCGGGCGTCACGACGAAGATC
CAAGTGCGGAGCGAGGAGGACAACGTGGCGGCCTTGGTGCTCACTTCAGTGGCATGA
Transcript >Ophun1|4393
ATGAGCTACGGGAAAAAGGACGAGGATGCAGACCTGGGCCTGGTCAAGGTTGACCGCACGCAGGTCTTCCAGGAA
GCCCGCCTGTTCAACAGCTCGCCCATCCAGCCGCGACGATGTCGAATTCTGCTCACCAAGATCGCCCTTCTCCTC
TATACGGGGGAGAAGTTCCCGGCAAATGAGGCCACCACGCTCTTCTTCGGCATCTCCAAGCTCTTCCAGAATAAA
GATGCCAGTCTGCGACAGATGGTCCACCTCATCATCAAGGAGCTGGCCAGCTCGGCTGAGGACATCATCATGGTC
ACCAGCACCATCATGAAGGATACCGGCGGCAGCAGCGACGCCATCTTCCGCCCCAATGCCATCCGTGCCCTGTGT
CGCATCATCGATGCGACGACCGTGCAATCCATCGAGCGCGTCATGAAGACTGCCATCGTGGATAAGAACCCTTCG
GTGTCTTCCGCCGCCTTGGTCTCGTCCTACCACCTCCTGCCCATCGCAAAGGATGTCGTGCGCCGTTGGCAGAGC
GAGACGCAAGAGGCTGCAGCCTCCACCAAGTCTTCCGGCGGCTTCTCACTCGGCTTCTCCTCCTCGAGCGGCCAG
ATGCCCATGAACAACTCCACCATGACGCAGTATCACGCCATCGGCCTGCTGTACCAGATGCGGATGCACGACAGG
ATGGCTCTCGTCAAGATGGTCCAGCAGTTCGGCGCTGCCGGCGCGGTCAAAAACCCTGCCGCCACCGTCATGCTC
GTCCGTCTCGCGGCTCAGCTGGCCGAGGAGGACGCCTCGCTGCGGAAGCCCATGATGCAGCTCCTCGACGGCTGG
TTGCGTCACAAGAGCGAAATGGTCAACTTTGAGGCCGCAAAGGCCATCTGTGATCTGAGGGACGTGTCCGACGCC
GAGGTCGCACAGGCCGTTCACGTCTTGCAGCTCTTCCTGTCGTCGCCGCGGGCCGTCACCAAGTTCGCCGCCCTC
CGCATCCTGCACAACTTTGCCTCTTTCAAGCCCAGCGCCGTGGCCGCCTGCAACCCGGACATTGAGCTCCTCATC
TCCAACAGCAACAGGTCCATCGCCACATTCGCCATCACCACGCTTCTCAAGACGGGCAACGAGGCCAGCGTGGAT
CGGCTGATGAAGCAGATATCGGGTTTCATGTCGGAAATCACCGACGAGTTCAAGGTCACCATCGTCGAGGCCATC
CGCACTCTGTGCCTCAAGTTCCCGAGCAAGCAGGCCGGCATGTTGACCTTCCTCAGCGGCATCCTCCGCGACGAG
GGCGGTTACGAGTTCAAGCGCGCCGTCGTGGAGAGCATGTTTGACCTCATCAAGTTCGTGCCGGATTCCAAGGAA
GAGGCCCTGGCCCATCTCTGCGAATTCATCGAGGACTGCGAGTTCACCAAACTCGCCGTCCGTATACTGCACCTC
ATCGGCCTGGAGGGACCCAAGACGACCCAGCCGACCAAGTACATCCGCTACATCTACAACCGTGTGGTGCTGGAG
AACGCCATCGTTCGGGCCGCGGCCGTCACCGCTCTGGCCAAGTTCGGTGTCGGTCAGAAGGATCCCGATGTCAAG
TCGAGCGTCAGGGTGCTACTCACTCGGTGTCTCGACGACGTCGATGACGAGGTCCGCGATCGTGCCGCCTTGAAT
TTGAAGCTCATGGGCGACGACAAGGACGACGAGACGGCGCAGAACTTTGTCAAGAATGGCAAGCCTTTCCATCAT
CCCCGACGCATCCTCACGACGGCTAACACCAACTTCCTAGAAAACATGTTCTCCCTTCCCATCTTCGAGCATCAA
CTCGTCATGTACGTCACATCGGACGACAAGTCGGCCTTTGACGACCCCTTCGACGTGACCAAGATTCCCGTCGTC
ACCCGCGAGCAGGCCGACGCCGAGGACAGGACGAAGAAGCTGACGGCGACGGCTCCTACGCTCAAGGCGCCCAAG
GTCGGCCCGGCCGCCAAGGCTCCTTCGAGCGGCGCCGAGGCTGCTGCGTCGGCTTCGGCTCAGGCGCAACGCTAC
GCCGAGACGCTGATGCGGATCCCGGAGATGGCCAACTTTGGCCACGTGCTCAAGTCTTCGCCGGTGGTGGAATTG
ACAGAGGCCGAGACGGAGTACGTGGTGACGCTGGTCAAGCACATCTTCAAGGAGCACATCGTGCTCCAATACGAG
GTGAAGAACACGCTTCCAGACACGGTGCTGGAGAATGTGTCTGTCGTGGCCACTCCATCCGAGGAGGAGGAGCTC
GAGGAGGAGTTCATCATTCCAGCCGAACGGCTGGTGACCAACGAGCCGGGCAGCGTCTACGTGGCCTTTAAAAAG
GTCAATGGCGAGTCGGCGCTACCCGTCACGTCCGTGTCCAACATCCTCAAGTTCACCAGCAAGGAGATCGACCCG
ACGACCAACGAGCCGGAAGAGACGGGCTACGATGACGAGTACGAGGTGTCCGAGTTTGACCTCGCCGGCAGCGAC
TACCTGGTGCCGACGTTTGCCAGCAACTTTAACCACCTGTGGGAGCAGATCGGCGCCTCGGGCGAGCAGGCGGAG
GAGACGCTGCAGCTGAGCGGCATGAAGAGCATTGCAGGCGAGTACCACTTGGCGACGGAGCAGCTGGCGAGGACC
TTGTCGCTGCAGCCATTGGACGGCACCGACGTGCCCATCAACCAGAGCACCCACACGCTCAAGCTTCTGGGCAAG
ACAGTCCTCGGAGGCAGGGTGGTGGCCACGGTGCGGATGGCGTATTCGTCCAAGTCGGGCGTCACGACGAAGATC
CAAGTGCGGAGCGAGGAGGACAACGTGGCGGCCTTGGTGCTCACTTCAGTGGCATGA
Gene >Ophun1|4393
ATGAGCTACGGGAAAAAGGACGAGGATGCAGACCTGGGCCTGGTCAAGGTTGACCGCACGCAGGTCTTCCAGGAA
GGTGAGCAGCAGATGATGGCCGTCGCCGCCCTTTGACGACGGCAACTCACTAACGCGACGACGCATCACAGCCCG
CCTGTTCAACAGCTCGCCCATCCAGCCGCGACGATGTCGAATTCTGCTCACCAAGATCGCCCTTCTCCTCTATAC
GGGGGAGAAGTTCCCGGCAAATGAGGCCACCACGCTCTTCTTCGGCATCTCCAAGCTCTTCCAGAATAAAGATGC
CAGTCTGCGACAGATGGTCCACCTCATCATCAAGGAGCTGGCCAGCTCGGCTGAGGACATCATCATGGTCACCAG
CACCATCATGAAGGATACCGGCGGCAGCAGCGACGCCATCTTCCGCCCCAATGCCATCCGTGCCCTGTGTCGCAT
CATCGATGTGCGTGAGCGGACGAAACCAGCGAGGCCCAGATCAAACTGCTGACGCGAGACATTCTTGCTAGGCGA
CGACCGTGCAATCCATCGAGCGCGTCATGAAGACTGCCATCGTGGATAAGAACCCTTCGGTGTCTTCCGCCGCCT
TGGTCTCGTCCTACCACCTCCTGCCCATCGCAAAGGATGTCGTGCGCCGTTGGCAGAGCGAGACGCAAGAGGCTG
CAGCCTCCACCAAGTCTTCCGGCGGCTTCTCACTCGGCTTCTCCTCCTCGAGCGGCCAGATGCCCATGAACAACT
CCACCATGACGCAGTATCACGCCATCGGCCTGCTGTACCAGATGCGGATGCACGACAGGATGGCTCTCGTCAAGA
TGGTCCAGCAGTTCGGCGCTGCCGGCGCGGTCAAAAACCCTGCCGCCACCGTCATGCTCGTCCGTCTCGCGGCTC
AGCTGGCCGAGGAGGACGCCTCGCTGCGGAAGCCCATGATGCAGCTCCTCGACGGCTGGTTGCGTCACAAGAGCG
AAATGGTCAACTTTGAGGCCGCAAAGGCCATCTGTGATCTGAGGGACGTGTCCGACGCCGAGGTCGCACAGGCCG
TTCACGTCTTGCAGCTCTTCCTGTCGTCGCCGCGGGCCGTCACCAAGTTCGCCGCCCTCCGCATCCTGCACAACT
TTGCCTCTTTCAAGCCCAGCGCCGTGGCCGCCTGCAACCCGGACATTGAGCTCCTCATCTCCAACAGCAACAGGT
CCATCGCCACATTCGCCATCACCACGCTTCTCAAGACGGGCAACGAGGCCAGCGTGGATCGGCTGATGAAGCAGA
TATCGGGTTTCATGTCGGAAATCACCGACGAGTTCAAGGTCACCATCGTCGAGGCCATCCGCACTCTGTGCCTCA
AGTTCCCGAGCAAGCAGGCCGGCATGTTGACCTTCCTCAGCGGCATCCTCCGCGACGAGGGCGGTTACGAGTTCA
AGCGCGCCGTCGTGGAGAGCATGTTTGACCTCATCAAGTTCGTGCCGGATTCCAAGGAAGAGGCCCTGGCCCATC
TCTGCGAATTCATCGAGGACTGCGAGTTCACCAAACTCGCCGTCCGTATACTGCACCTCATCGGCCTGGAGGGAC
CCAAGACGACCCAGCCGACCAAGTACATCCGCTACATCTACAACCGTGTGGTGCTGGAGAACGCCATCGTTCGGG
CCGCGGCCGTCACCGCTCTGGCCAAGTTCGGTGTCGGTCAGAAGGATCCCGATGTCAAGTCGAGCGTCAGGGTGC
TACTCACTCGGTGTCTCGACGACGTCGATGACGAGGTCCGCGATCGTGCCGCCTTGAATTTGAAGCTCATGGGCG
ACGACAAGGACGACGAGACGGCGCAGAACTTTGTCAAGAATGGCAAGCCTTTCCATCATCCCCGACGCATCCTCA
CGACGGCTAACACCAACTTCCTAGAAAACATGTTCTCCCTTCCCATCTTCGAGCATCAACTCGTCATGTACGTCA
CATCGGACGACAAGTCGGCCTTTGACGACCCCTTCGACGTGACCAAGATTCCCGTCGTCACCCGCGAGCAGGCCG
ACGCCGAGGACAGGACGAAGAAGCTGACGGCGACGGCTCCTACGCTCAAGGCGCCCAAGGTCGGCCCGGCCGCCA
AGGCTCCTTCGAGCGGCGCCGAGGCTGCTGCGTCGGCTTCGGCTCAGGCGCAACGCTACGCCGAGACGCTGATGC
GGATCCCGGAGATGGCCAACTTTGGCCACGTGCTCAAGTCTTCGCCGGTGGTGGAATTGACAGAGGCCGAGACGG
AGTACGTGGTGACGCTGGTCAAGCACATCTTCAAGGAGCACATCGTGCTCCAATACGAGGTGAAGAACACGCTTC
CAGACACGGTGCTGGAGAATGTGTCTGTCGTGGCCACTCCATCCGAGGAGGAGGAGCTCGAGGAGGAGTTCATCA
TTCCAGCCGAACGGCTGGTGACCAACGAGCCGGGCAGCGTCTACGTGGCCTTTAAAAAGGTCAATGGCGAGTCGG
CGCTACCCGTCACGTCCGTGTCCAACATCCTCAAGTTCACCAGCAAGGAGATCGACCCGACGACCAACGAGCCGG
AAGAGACGGGCTACGATGACGAGTACGAGGTGTCCGAGTTTGACCTCGCCGGCAGCGACTACCTGGTGCCGACGT
TTGCCAGCAACTTTAACCACCTGTGGGAGCAGATCGGCGCCTCGGGCGAGCAGGCGGAGGAGACGCTGCAGCTGA
GCGGCATGAAGAGCATTGCAGGCGAGTACCACTTGGTGGCGCACCGGTCTGGGACTGCGGCTGACTCGGCATGGA
TGAAACAGAGGCGACGGAGCAGCTGGCGAGGACCTTGTCGCTGCAGCCATTGGACGGCACCGACGTGCCCATCAA
CCAGAGCACCCACACGCTCAAGCTTCTGGGCAAGACAGTCCTCGGAGGCAGGGTGGTGGCCACGGTGCGGATGGC
GTATTCGTCCAAGTCGGGCGTCACGACGAAGATCCAAGTGCGGAGCGAGGAGGACAACGTGGCGGCCTTGGTGCT
CACTTCAGTGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail