Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4388
Gene name
LocationContig_402:6322..9758
Strand+
Gene length (bp)3436
Transcript length (bp)3006
Coding sequence length (bp)3006
Protein length (aa) 1002

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 9.1E-68 713 981
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 4.2E-53 715 976
PF00786 PBD P21-Rho-binding domain 4.8E-22 328 384
PF03109 ABC1 ABC1 atypical kinase-like domain 2.4E-05 801 880

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 213 998 5.0E-164
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 630 998 5.0E-125
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 655 994 3.0E-115
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 691 1000 1.0E-114
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 691 1000 2.0E-114
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 213 998 5.0E-164
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 630 998 5.0E-125
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 655 994 3.0E-115
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 691 1000 1.0E-114
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 691 1000 2.0E-114
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 691 1000 2.0E-114
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 669 998 2.0E-114
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 680 1001 8.0E-114
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 691 1000 3.0E-113
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 644 1000 6.0E-113
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 680 1000 4.0E-112
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 657 1000 5.0E-112
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 680 1000 7.0E-112
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 680 1000 7.0E-112
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 680 1000 7.0E-112
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 655 994 1.0E-111
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 687 1000 3.0E-111
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 687 1000 4.0E-111
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 648 1000 4.0E-111
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 687 1000 5.0E-111
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 687 1000 5.0E-111
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 513 998 3.0E-110
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 695 1001 9.0E-110
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 661 994 3.0E-109
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 668 996 5.0E-109
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 660 994 2.0E-108
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 546 994 2.0E-108
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 638 1001 2.0E-108
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 695 1001 2.0E-107
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 695 1001 2.0E-107
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 695 1001 2.0E-107
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 544 1001 3.0E-106
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 695 1001 2.0E-105
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 695 1001 1.0E-104
sp|Q12469|SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKM1 PE=1 SV=1 695 985 4.0E-103
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 691 1000 5.0E-101
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 691 990 2.0E-90
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 683 999 2.0E-86
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 691 994 1.0E-82
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 691 994 1.0E-82
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 674 999 1.0E-81
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 674 999 1.0E-81
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 677 999 3.0E-81
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 700 985 5.0E-80
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 695 1001 6.0E-78
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 690 981 6.0E-75
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 690 981 6.0E-75
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 691 981 7.0E-75
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 700 985 3.0E-73
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 656 994 6.0E-71
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 697 994 6.0E-61
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 697 994 7.0E-61
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 697 995 9.0E-61
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 697 994 1.0E-60
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 699 994 2.0E-60
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 697 994 3.0E-60
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 697 994 4.0E-60
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 697 994 4.0E-60
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 697 994 4.0E-60
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 697 994 5.0E-60
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 697 994 5.0E-60
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 697 994 7.0E-60
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 697 994 8.0E-60
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 697 994 9.0E-60
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 697 994 9.0E-60
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 697 982 1.0E-59
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 697 982 1.0E-59
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 697 994 2.0E-59
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 703 994 3.0E-59
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 697 994 6.0E-59
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 704 994 1.0E-58
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 697 994 1.0E-58
sp|Q55DD4|PAKD_DICDI Serine/threonine-protein kinase pakD OS=Dictyostelium discoideum GN=pakD PE=3 SV=1 700 992 7.0E-56
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 718 990 4.0E-55
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 706 981 1.0E-54
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 706 981 2.0E-54
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 705 981 2.0E-54
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 705 981 2.0E-54
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 705 981 2.0E-54
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 706 981 2.0E-54
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 699 985 2.0E-54
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 708 982 4.0E-54
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 708 982 5.0E-54
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 712 986 6.0E-53
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 708 981 9.0E-53
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 701 981 1.0E-52
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 708 982 1.0E-52
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 708 981 1.0E-52
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 691 982 2.0E-52
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 704 982 1.0E-51
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 708 982 2.0E-51
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 697 994 2.0E-51
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 708 982 2.0E-51
sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 697 994 2.0E-51
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 697 984 5.0E-50
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 700 984 7.0E-50
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 704 981 9.0E-50
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 704 981 1.0E-49
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 704 981 1.0E-49
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 697 994 2.0E-49
sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 704 981 4.0E-49
sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens GN=MAP4K3 PE=1 SV=1 704 981 4.0E-49
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 697 994 8.0E-49
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 694 981 9.0E-49
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 713 982 1.0E-48
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 708 981 1.0E-48
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 713 995 1.0E-48
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 694 981 2.0E-48
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 708 981 3.0E-48
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 694 981 3.0E-48
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 712 999 3.0E-48
sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens GN=SLK PE=1 SV=1 718 981 9.0E-48
sp|Q7Z2Y5|NRK_HUMAN Nik-related protein kinase OS=Homo sapiens GN=NRK PE=1 SV=2 708 982 3.0E-47
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 708 999 5.0E-47
sp|Q9R0G8|NRK_MOUSE Nik-related protein kinase OS=Mus musculus GN=Nrk PE=1 SV=2 708 981 6.0E-47
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 717 994 7.0E-47
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 708 981 8.0E-47
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 686 995 8.0E-46
sp|Q54TN4|MKCE_DICDI Probable serine/threonine-protein kinase mkcE OS=Dictyostelium discoideum GN=mkcE PE=3 SV=1 664 994 2.0E-45
sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens GN=MAP4K4 PE=1 SV=2 708 982 2.0E-45
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 713 981 2.0E-45
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 686 995 2.0E-45
sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 708 999 3.0E-45
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 702 995 3.0E-45
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 686 995 4.0E-45
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 686 995 5.0E-45
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 702 995 7.0E-45
sp|Q7ZYJ0|TAO1B_XENLA Serine/threonine-protein kinase TAO1-B OS=Xenopus laevis GN=taok1-b PE=2 SV=1 702 1000 8.0E-45
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 673 994 8.0E-45
sp|P97820|M4K4_MOUSE Mitogen-activated protein kinase kinase kinase kinase 4 OS=Mus musculus GN=Map4k4 PE=1 SV=1 708 982 2.0E-44
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 719 981 3.0E-44
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 713 995 4.0E-44
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 686 995 4.0E-44
sp|Q6NU21|TAO1A_XENLA Serine/threonine-protein kinase TAO1-A OS=Xenopus laevis GN=taok1-a PE=2 SV=1 700 1000 4.0E-44
sp|Q6ZQ29|TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus GN=Taok2 PE=1 SV=3 702 1000 5.0E-44
sp|Q9H2K8|TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens GN=TAOK3 PE=1 SV=2 706 994 6.0E-44
sp|Q9JLS3|TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus GN=Taok2 PE=1 SV=1 702 1000 9.0E-44
sp|Q9UL54|TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens GN=TAOK2 PE=1 SV=2 702 1000 9.0E-44
sp|Q5F2E8|TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus GN=Taok1 PE=1 SV=1 699 1000 9.0E-44
sp|O88664|TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus GN=Taok1 PE=1 SV=1 699 1000 9.0E-44
sp|Q7L7X3|TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens GN=TAOK1 PE=1 SV=1 699 1000 1.0E-43
sp|Q6GPK9|TAOK2_XENLA Serine/threonine-protein kinase TAO2 OS=Xenopus laevis GN=taok2 PE=2 SV=1 702 1000 1.0E-43
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 696 981 3.0E-43
sp|Q6DD27|TAOK3_XENLA Serine/threonine-protein kinase TAO3 OS=Xenopus laevis GN=taok3 PE=2 SV=1 704 1000 5.0E-43
sp|Q54MY9|MKCA_DICDI Probable serine/threonine-protein kinase mkcA OS=Dictyostelium discoideum GN=mkcA PE=2 SV=1 713 982 6.0E-43
sp|Q8BYC6|TAOK3_MOUSE Serine/threonine-protein kinase TAO3 OS=Mus musculus GN=Taok3 PE=1 SV=2 706 994 1.0E-42
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 705 998 2.0E-42
sp|Q5R4F3|TAOK3_PONAB Serine/threonine-protein kinase TAO3 OS=Pongo abelii GN=TAOK3 PE=2 SV=1 706 994 2.0E-42
sp|Q53UA7|TAOK3_RAT Serine/threonine-protein kinase TAO3 OS=Rattus norvegicus GN=Taok3 PE=1 SV=1 702 994 2.0E-42
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 708 981 2.0E-42
sp|Q54EY4|DST3_DICDI Serine/threonine-protein kinase dst3 OS=Dictyostelium discoideum GN=dst3 PE=3 SV=1 704 984 4.0E-42
sp|Q8SSV3|MKCD_DICDI Probable serine/threonine-protein kinase mkcD OS=Dictyostelium discoideum GN=mkcD PE=3 SV=1 700 994 4.0E-42
sp|Q9I9E0|TAOK3_CHICK Serine/threonine-protein kinase TAO3 OS=Gallus gallus GN=TAOK3 PE=2 SV=2 706 1000 4.0E-42
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 772 978 8.0E-42
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 703 982 1.0E-41
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 713 983 1.0E-41
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 703 982 1.0E-41
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 703 982 2.0E-41
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 707 981 2.0E-41
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 703 982 3.0E-41
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 702 982 6.0E-41
sp|Q551H4|FRAY2_DICDI Serine/threonine-protein kinase fray2 OS=Dictyostelium discoideum GN=fray2 PE=3 SV=1 706 982 3.0E-40
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 713 983 3.0E-40
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 681 981 7.0E-40
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 713 983 1.0E-39
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 712 986 2.0E-39
sp|Q54XL6|FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum GN=fray1 PE=3 SV=1 713 982 3.0E-39
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 681 981 3.0E-39
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 711 980 3.0E-39
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 673 981 5.0E-39
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 711 980 8.0E-39
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 712 982 9.0E-39
sp|P46549|SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans GN=kin-18 PE=2 SV=1 704 994 9.0E-39
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 712 982 1.0E-38
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 712 982 1.0E-38
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 683 993 1.0E-38
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 717 983 3.0E-38
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 713 978 9.0E-38
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 649 980 1.0E-37
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 703 982 9.0E-37
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 690 981 1.0E-36
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 709 987 1.0E-36
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 709 983 1.0E-36
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 713 982 3.0E-36
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 702 982 3.0E-36
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 709 981 5.0E-36
sp|P23561|STE11_YEAST Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE11 PE=1 SV=3 762 981 7.0E-36
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 717 983 7.0E-36
sp|A7A1P0|STE11_YEAS7 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain YJM789) GN=STE11 PE=3 SV=1 762 981 7.0E-36
sp|P10676|NINAC_DROME Neither inactivation nor afterpotential protein C OS=Drosophila melanogaster GN=ninaC PE=1 SV=2 708 981 1.0E-35
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 712 994 1.0E-35
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 709 996 1.0E-35
sp|B5VNQ3|STE11_YEAS6 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=STE11 PE=3 SV=2 570 981 2.0E-35
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 689 981 3.0E-35
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 703 982 4.0E-35
sp|O80396|M2K3_ARATH Mitogen-activated protein kinase kinase 3 OS=Arabidopsis thaliana GN=MKK3 PE=1 SV=1 753 983 1.0E-34
sp|Q54DC8|Y2350_DICDI Probable serine/threonine-protein kinase DDB_G0292350 OS=Dictyostelium discoideum GN=DDB_G0292350 PE=3 SV=1 713 981 1.0E-34
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 713 982 3.0E-34
sp|O23304|BLUS1_ARATH Serine/threonine-protein kinase BLUS1 OS=Arabidopsis thaliana GN=BLUS1 PE=1 SV=1 712 983 4.0E-34
sp|Q12469|SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKM1 PE=1 SV=1 215 386 5.0E-34
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 691 982 5.0E-34
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 704 982 7.0E-34
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 703 981 1.0E-33
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 713 981 2.0E-33
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 703 981 2.0E-33
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 685 981 3.0E-33
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 713 981 4.0E-33
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 713 982 5.0E-33
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 713 978 5.0E-33
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 719 978 6.0E-33
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 668 982 7.0E-33
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 689 981 1.0E-32
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 712 981 1.0E-32
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 666 981 1.0E-32
sp|Q9FJV0|M2K6_ARATH Mitogen-activated protein kinase kinase 6 OS=Arabidopsis thaliana GN=MKK6 PE=1 SV=1 717 982 1.0E-32
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 712 981 1.0E-32
sp|Q54C77|Y3184_DICDI Probable inactive serine/threonine-protein kinase DDB_G0293184 OS=Dictyostelium discoideum GN=DDB_G0293184 PE=3 SV=1 743 981 2.0E-32
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 713 981 3.0E-32
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 712 981 3.0E-32
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 713 982 4.0E-32
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 713 986 4.0E-32
sp|Q94A06|M2K1_ARATH Mitogen-activated protein kinase kinase 1 OS=Arabidopsis thaliana GN=MKK1 PE=1 SV=2 717 982 4.0E-32
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 713 969 6.0E-32
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 685 981 9.0E-32
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 693 969 1.0E-31
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 712 984 1.0E-31
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 689 981 1.0E-31
sp|P06784|STE7_YEAST Serine/threonine-protein kinase STE7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE7 PE=1 SV=1 718 981 2.0E-31
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 692 969 3.0E-31
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 692 969 3.0E-31
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 712 984 4.0E-31
sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 712 981 5.0E-31
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 689 981 5.0E-31
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 689 981 7.0E-31
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 717 981 8.0E-31
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 689 981 8.0E-31
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 713 978 8.0E-31
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 692 969 9.0E-31
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 712 981 1.0E-30
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 692 969 1.0E-30
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 692 969 1.0E-30
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 692 969 1.0E-30
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 713 969 2.0E-30
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 712 984 2.0E-30
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 743 983 2.0E-30
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 692 969 2.0E-30
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 719 984 2.0E-30
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 692 969 2.0E-30
sp|Q55CE0|MKCF_DICDI Probable serine/threonine-protein kinase mkcF OS=Dictyostelium discoideum GN=mkcF PE=3 SV=1 719 982 3.0E-30
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 711 982 3.0E-30
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 713 969 3.0E-30
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 710 992 3.0E-30
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 710 987 3.0E-30
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 692 969 3.0E-30
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 702 965 4.0E-30
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 692 969 4.0E-30
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 713 969 1.0E-29
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 712 984 1.0E-29
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 712 991 1.0E-29
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 710 934 1.0E-29
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 595 933 1.0E-29
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 712 984 1.0E-29
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 713 983 1.0E-29
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 692 969 1.0E-29
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 711 982 1.0E-29
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 712 984 1.0E-29
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 738 981 2.0E-29
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 713 981 2.0E-29
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 713 978 2.0E-29
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 717 986 2.0E-29
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 710 987 2.0E-29
sp|P32490|MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK1 PE=1 SV=1 719 982 2.0E-29
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 692 969 2.0E-29
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 717 982 2.0E-29
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 658 986 2.0E-29
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 713 984 3.0E-29
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 692 969 3.0E-29
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 713 984 3.0E-29
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 712 984 3.0E-29
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 719 982 4.0E-29
sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 670 929 4.0E-29
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 599 924 4.0E-29
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 717 981 4.0E-29
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 719 986 4.0E-29
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 692 984 5.0E-29
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 719 982 5.0E-29
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 719 986 5.0E-29
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 719 986 5.0E-29
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 719 924 5.0E-29
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 719 983 5.0E-29
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 719 983 6.0E-29
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 719 986 6.0E-29
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 719 983 6.0E-29
sp|P32491|MKK2_YEAST MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK2 PE=1 SV=2 719 981 7.0E-29
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 719 983 7.0E-29
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 711 981 7.0E-29
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 712 984 7.0E-29
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 719 983 8.0E-29
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 729 978 8.0E-29
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 712 936 9.0E-29
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 719 982 1.0E-28
sp|Q21029|NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans GN=nsy-1 PE=1 SV=4 719 984 1.0E-28
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 712 982 1.0E-28
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 732 978 1.0E-28
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 719 982 2.0E-28
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 713 969 2.0E-28
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 715 986 2.0E-28
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 712 936 2.0E-28
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 732 978 2.0E-28
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 712 984 2.0E-28
sp|Q8VCR8|MYLK2_MOUSE Myosin light chain kinase 2, skeletal/cardiac muscle OS=Mus musculus GN=Mylk2 PE=1 SV=2 711 983 2.0E-28
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 712 928 2.0E-28
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 763 995 2.0E-28
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 712 924 2.0E-28
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 712 928 2.0E-28
sp|Q9NBK5|TRC_DROME Serine/threonine-protein kinase tricorner OS=Drosophila melanogaster GN=trc PE=1 SV=1 670 929 2.0E-28
sp|A4IFM7|MYLK2_BOVIN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Bos taurus GN=MYLK2 PE=2 SV=1 711 983 2.0E-28
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 745 982 3.0E-28
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 713 917 3.0E-28
sp|P20689|MYLK2_RAT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Rattus norvegicus GN=Mylk2 PE=1 SV=2 711 983 3.0E-28
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 713 987 3.0E-28
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 713 981 3.0E-28
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 692 984 4.0E-28
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 717 969 4.0E-28
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 694 984 4.0E-28
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 719 924 5.0E-28
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 713 986 5.0E-28
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 712 982 6.0E-28
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 712 982 6.0E-28
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 713 969 6.0E-28
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 713 981 7.0E-28
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 732 978 7.0E-28
sp|P23647|FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster GN=fu PE=1 SV=2 713 982 7.0E-28
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 713 986 7.0E-28
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 717 982 7.0E-28
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 712 936 7.0E-28
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 713 981 7.0E-28
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 690 958 8.0E-28
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 707 998 8.0E-28
sp|Q3UIZ8|MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus GN=Mylk3 PE=1 SV=1 611 983 9.0E-28
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 717 924 9.0E-28
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 685 982 9.0E-28
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 713 986 1.0E-27
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 713 986 1.0E-27
sp|Q86YV6|MYLK4_HUMAN Myosin light chain kinase family member 4 OS=Homo sapiens GN=MYLK4 PE=1 SV=2 714 981 1.0E-27
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 713 981 1.0E-27
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 572 924 1.0E-27
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 713 928 1.0E-27
sp|Q8LST2|WNK7_ARATH Probable serine/threonine-protein kinase WNK7 OS=Arabidopsis thaliana GN=WNK7 PE=2 SV=1 708 981 1.0E-27
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 732 978 1.0E-27
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 598 924 1.0E-27
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 709 978 1.0E-27
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 590 924 2.0E-27
sp|Q9CAV6|WNK1_ARATH Serine/threonine-protein kinase WNK1 OS=Arabidopsis thaliana GN=WNK1 PE=1 SV=1 708 982 2.0E-27
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 713 983 2.0E-27
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 713 984 2.0E-27
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 713 962 2.0E-27
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 713 978 2.0E-27
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 690 958 2.0E-27
sp|A8X775|DLK1_CAEBR Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis briggsae GN=dlk-1 PE=3 SV=1 729 978 3.0E-27
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 713 986 3.0E-27
sp|E9PT87|MYLK3_RAT Myosin light chain kinase 3 OS=Rattus norvegicus GN=Mylk3 PE=1 SV=1 712 983 3.0E-27
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 713 972 3.0E-27
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 713 987 3.0E-27
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 713 962 3.0E-27
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 719 924 3.0E-27
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 701 924 4.0E-27
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 715 981 4.0E-27
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 753 984 4.0E-27
sp|P07313|MYLK2_RABIT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Oryctolagus cuniculus GN=MYLK2 PE=1 SV=3 711 983 4.0E-27
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 713 962 4.0E-27
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 713 924 4.0E-27
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 675 958 5.0E-27
sp|Q55CL6|MP2K1_DICDI Dual specificity mitogen-activated protein kinase kinase 1 OS=Dictyostelium discoideum GN=mekA PE=1 SV=1 708 924 5.0E-27
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 732 982 5.0E-27
sp|Q9H1R3|MYLK2_HUMAN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Homo sapiens GN=MYLK2 PE=1 SV=3 711 983 5.0E-27
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 719 930 5.0E-27
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 717 924 6.0E-27
sp|Q8S8Y9|WNK2_ARATH Serine/threonine-protein kinase WNK2 OS=Arabidopsis thaliana GN=WNK2 PE=1 SV=1 708 982 6.0E-27
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 713 982 6.0E-27
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 712 986 6.0E-27
sp|Q5RDG7|MYLK3_PONAB Myosin light chain kinase 3 OS=Pongo abelii GN=MYLK3 PE=2 SV=3 610 981 6.0E-27
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 713 984 6.0E-27
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 712 924 6.0E-27
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 717 929 7.0E-27
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 690 958 7.0E-27
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 713 976 7.0E-27
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 701 931 7.0E-27
sp|Q54TH6|Y9863_DICDI Probable serine/threonine-protein kinase DDB_G0281745 OS=Dictyostelium discoideum GN=DDB_G0281745 PE=3 SV=1 703 923 8.0E-27
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 713 990 8.0E-27
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 713 934 8.0E-27
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 690 981 8.0E-27
sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens GN=MAP3K6 PE=1 SV=3 719 984 9.0E-27
sp|Q32MK0|MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens GN=MYLK3 PE=2 SV=3 715 981 9.0E-27
sp|Q2V338|WNK9_ARATH Probable serine/threonine-protein kinase WNK9 OS=Arabidopsis thaliana GN=WNK9 PE=2 SV=1 708 981 9.0E-27
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 700 982 9.0E-27
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 717 959 9.0E-27
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 717 924 1.0E-26
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 690 948 1.0E-26
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 690 948 1.0E-26
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 717 959 1.0E-26
sp|A2YMV6|WNK1_ORYSI Probable serine/threonine-protein kinase WNK1 OS=Oryza sativa subsp. indica GN=WNK1 PE=2 SV=2 708 982 1.0E-26
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 713 982 1.0E-26
sp|Q0D598|WNK1_ORYSJ Probable serine/threonine-protein kinase WNK1 OS=Oryza sativa subsp. japonica GN=WNK1 PE=2 SV=1 708 982 1.0E-26
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 717 924 1.0E-26
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 717 924 1.0E-26
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 717 959 1.0E-26
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 717 982 1.0E-26
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 717 924 1.0E-26
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 661 962 1.0E-26
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 713 971 1.0E-26
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 713 984 1.0E-26
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 691 958 2.0E-26
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 717 932 2.0E-26
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 697 982 2.0E-26
sp|P07934|PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus GN=Phkg1 PE=1 SV=3 712 982 2.0E-26
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 682 981 2.0E-26
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 717 924 2.0E-26
sp|Q4R8T9|CDKL3_MACFA Cyclin-dependent kinase-like 3 OS=Macaca fascicularis GN=CDKL3 PE=2 SV=1 713 981 2.0E-26
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 631 924 2.0E-26
sp|P87050|CDR2_SCHPO Mitosis inducer protein kinase cdr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr2 PE=1 SV=1 719 981 2.0E-26
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 717 959 2.0E-26
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 743 982 2.0E-26
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 713 934 2.0E-26
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 713 981 2.0E-26
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 700 982 2.0E-26
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 655 930 2.0E-26
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 717 987 2.0E-26
sp|Q8IVW4|CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens GN=CDKL3 PE=1 SV=1 713 981 2.0E-26
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 713 978 2.0E-26
sp|P13286|PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus GN=Phkg1 PE=2 SV=2 712 982 2.0E-26
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 655 930 2.0E-26
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 690 958 2.0E-26
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 689 960 2.0E-26
sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1 661 929 2.0E-26
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 749 984 2.0E-26
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 717 924 3.0E-26
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 717 924 3.0E-26
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 713 982 3.0E-26
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 713 1000 3.0E-26
sp|P53349|M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus GN=Map3k1 PE=1 SV=3 713 982 4.0E-26
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 749 984 4.0E-26
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 690 960 4.0E-26
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 717 924 4.0E-26
sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens GN=MAP3K1 PE=1 SV=4 713 982 4.0E-26
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 713 978 4.0E-26
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 719 981 4.0E-26
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 717 924 4.0E-26
sp|P00518|PHKG1_RABIT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus GN=PHKG1 PE=1 SV=2 712 982 4.0E-26
sp|Q13163|MP2K5_HUMAN Dual specificity mitogen-activated protein kinase kinase 5 OS=Homo sapiens GN=MAP2K5 PE=1 SV=2 648 981 4.0E-26
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 713 986 4.0E-26
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 717 981 4.0E-26
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 663 924 5.0E-26
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 719 984 5.0E-26
sp|Q6AXJ9|CDKL1_DANRE Cyclin-dependent kinase-like 1 OS=Danio rerio GN=cdkl1 PE=2 SV=1 713 962 5.0E-26
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 717 924 5.0E-26
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 702 924 5.0E-26
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 717 982 5.0E-26
sp|O22558|STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana GN=STY8 PE=1 SV=2 733 976 5.0E-26
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 709 962 6.0E-26
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 698 960 6.0E-26
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 700 984 6.0E-26
sp|O42632|KPC1_COCHE Protein kinase C-like OS=Cochliobolus heterostrophus GN=PKC1 PE=3 SV=1 719 928 6.0E-26
sp|P10506|BYR1_SCHPO Protein kinase byr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr1 PE=1 SV=1 707 982 6.0E-26
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 707 982 6.0E-26
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 700 984 6.0E-26
sp|Q2PJ68|SGK1_CAEEL Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis elegans GN=sgk-1 PE=1 SV=1 719 945 6.0E-26
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 709 989 6.0E-26
sp|Q54IF2|Y0670_DICDI Probable serine/threonine-protein kinase DDB_G0288795 OS=Dictyostelium discoideum GN=DDB_G0288795 PE=2 SV=1 717 983 6.0E-26
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 712 986 6.0E-26
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 717 924 7.0E-26
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 700 982 7.0E-26
sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus GN=Prkcg PE=1 SV=1 713 959 7.0E-26
sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus GN=Prkcg PE=1 SV=1 713 959 7.0E-26
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 700 984 7.0E-26
sp|P05128|KPCG_BOVIN Protein kinase C gamma type (Fragment) OS=Bos taurus GN=PRKCG PE=2 SV=1 713 959 7.0E-26
sp|Q5E9X2|MP2K6_BOVIN Dual specificity mitogen-activated protein kinase kinase 6 OS=Bos taurus GN=MAP2K6 PE=2 SV=1 718 981 7.0E-26
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 713 982 8.0E-26
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 719 982 8.0E-26
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 717 924 8.0E-26
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 709 962 8.0E-26
sp|Q3SZW1|TSSK1_BOVIN Testis-specific serine/threonine-protein kinase 1 OS=Bos taurus GN=TSSK1B PE=2 SV=1 750 982 9.0E-26
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 713 984 9.0E-26
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 702 981 9.0E-26
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 717 982 9.0E-26
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 717 987 9.0E-26
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 717 924 9.0E-26
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 713 991 9.0E-26
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 719 928 9.0E-26
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 698 982 9.0E-26
sp|Q9XTG7|AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans GN=akt-2 PE=1 SV=1 701 962 9.0E-26
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 717 924 9.0E-26
sp|A8XNJ6|SGK1_CAEBR Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis briggsae GN=sgk-1 PE=3 SV=3 719 945 9.0E-26
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 713 982 9.0E-26
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 713 983 9.0E-26
sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens GN=PRKCG PE=1 SV=3 713 959 1.0E-25
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 713 982 1.0E-25
sp|Q01577|PKPA_PHYB8 Serine/threonine-protein kinase pkpA OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=pkpA PE=2 SV=1 702 981 1.0E-25
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 713 941 1.0E-25
sp|P52564|MP2K6_HUMAN Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens GN=MAP2K6 PE=1 SV=1 718 994 1.0E-25
sp|Q9LPQ3|M2K7_ARATH Mitogen-activated protein kinase kinase 7 OS=Arabidopsis thaliana GN=MKK7 PE=1 SV=1 715 982 1.0E-25
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 746 981 8.0E-24
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 749 981 3.0E-23
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 209 409 1.0E-22
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 746 978 4.0E-22
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 746 978 5.0E-22
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 746 926 3.0E-21
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 746 978 3.0E-21
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 746 983 7.0E-21
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 746 983 7.0E-21
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 748 981 9.0E-21
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 689 981 9.0E-21
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 774 978 3.0E-19
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 328 401 8.0E-16
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 328 401 8.0E-16
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 328 401 9.0E-16
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 328 401 9.0E-16
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 328 429 2.0E-15
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 328 401 1.0E-14
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 328 405 6.0E-14
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 328 405 7.0E-14
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 328 405 7.0E-14
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 328 405 7.0E-14
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 328 386 7.0E-12
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 328 386 8.0E-12
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 328 387 8.0E-12
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 328 401 1.0E-11
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 328 388 1.0E-11
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 328 401 2.0E-11
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 328 401 2.0E-11
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 328 401 2.0E-11
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 328 401 2.0E-11
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 328 389 2.0E-11
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 328 391 2.0E-11
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 328 439 6.0E-11
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 314 384 2.0E-10
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 295 396 2.0E-10
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 328 433 3.0E-10
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 328 384 6.0E-10
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 328 392 1.0E-09
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 328 437 2.0E-09
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 328 394 2.0E-09
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 328 394 2.0E-09
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 328 394 2.0E-09
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 328 390 4.0E-09
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 328 384 7.0E-07
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 298 400 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4388
MQLEPRDAVLAIIITTTTTSRSSNSNNNTSSTTITTTITTTTTTSSSSSDPPPILGSARHTSPPFPTLCEASYSS
VPLPPASHHVVSSCRRKSVDEARQLPCAGFSSSAERGSKPRTREAVSRHLLHTSHPLRFANVIASVYSSGQFMNP
GPAPRPPGDRPRLNLTPSPNLSGNMASMAISPNRSTTTSTYTGSTISLPIARQHSNNIDGKGGVAVKKEGWASVK
ESKNFIQPWKSKYLILRKESLDFHKAEGGKVAYTLYLRDVVNVGRVEQAGTIFEIKRKVDGISSSPGDDDGQNKT
LQIKVKSDDDLYEWIDLIYGACPGMGGVSNPTNFSHAVHVGFDPQTGEFIGLPPEWSKLLNSSAITKEDYERNPQ
AVFEVLDFYTDLAKRAENPTQYSSLTPTPPAMSSNQNKPLPYTNGGSSIVPPRQAPSAPGLPRNMSYANTSQQPG
VSPQRRPAPSEQQQPQPQRQQMPVMSSGYGSQDAMREEQRRKQLEAQRQREVDEMQKRELEEYNASLPKTKVPLA
QQEVGGYGGGTPSPQAATDRFTPARPAPSPMTKQAGTPATSLRAQRPAPSAPTTAGASARPPVSAQSMSSRDTAG
QAARAAVGADSSNGPGSLRQQNGSQTSLARPPQAQAQTQAASRLPAPVKPLNVTPKPSQPQQSDSVKAAEAALTA
KPPATERKQDVRMSTMSETEVMAKLKEAVSKDDPNMSYSKQKKIGQGASGSVYVAKIKDTAQGIAREVLRQQGSR
AQVAIKQMDLAHQPRKELIVNEIMVMKDSRHRNIVNFLDAFLRNNNAELWVVMEYMEGGALTDVIDNNPSISEEQ
ISTICHETCSGLQHLHSQSIIHRDIKSDNVLLDARGNVKITDFGFCAKLTETKSKRATMVGTPYWMAPEVVKQKE
YGPKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKKPEKLSKELKAFLSVCLCVDIKSRASADEL
LAHDFLKHGCPLASLADLLAFKKHAK*
Coding >Ophun1|4388
ATGCAACTAGAGCCTCGGGATGCCGTACTGGCCATCATCATCACCACCACCACTACCAGCAGGAGCAGCAACAGC
AACAACAACACCTCCTCCACCACCATCACCACCACCATCACCACCACCACCACCACCTCCTCCTCCTCCTCCGAT
CCTCCTCCGATCCTCGGATCCGCTCGCCACACGTCTCCCCCTTTCCCAACTCTCTGCGAGGCATCCTACTCATCG
GTGCCTCTGCCGCCTGCCAGCCATCACGTCGTCTCTTCCTGTCGCCGGAAGTCGGTCGACGAGGCCCGACAGCTT
CCTTGCGCCGGCTTCTCCTCGTCTGCCGAGCGCGGCTCCAAACCTCGCACGCGCGAGGCTGTCTCCCGCCACCTG
CTGCATACCTCACATCCACTCCGCTTCGCTAACGTCATCGCCAGCGTTTACTCGTCGGGCCAGTTCATGAACCCT
GGCCCTGCGCCCCGGCCTCCCGGCGACAGGCCGCGCCTGAATCTGACGCCCAGTCCAAACCTTTCCGGAAACATG
GCAAGCATGGCCATCTCCCCCAACCGAAGCACGACCACGTCGACTTACACAGGCTCCACCATCTCTCTGCCCATC
GCTCGCCAGCACTCCAACAACATCGACGGCAAGGGGGGCGTCGCTGTCAAGAAAGAAGGCTGGGCCTCGGTCAAG
GAGAGCAAGAACTTCATCCAGCCCTGGAAGTCCAAGTACCTGATACTCCGCAAGGAGTCGCTCGACTTTCACAAG
GCCGAGGGTGGCAAGGTCGCTTACACGCTCTACCTGAGGGACGTGGTCAATGTCGGCAGGGTCGAGCAGGCCGGC
ACCATATTCGAAATCAAGAGAAAGGTTGACGGCATCTCGAGCAGCCCCGGCGACGACGACGGCCAAAACAAGACG
TTGCAGATCAAGGTCAAGAGCGACGACGACCTGTACGAGTGGATCGACCTCATCTACGGCGCCTGTCCTGGCATG
GGCGGCGTCAGCAACCCGACCAACTTCTCTCACGCCGTCCACGTCGGTTTCGACCCTCAGACGGGAGAGTTTATA
GGACTCCCTCCCGAGTGGTCCAAACTCCTCAACTCGTCTGCCATCACCAAGGAAGACTATGAGCGCAACCCGCAG
GCCGTCTTCGAGGTTCTCGACTTCTATACCGATCTCGCCAAGCGAGCCGAGAACCCGACCCAATATTCGAGCCTC
ACGCCCACGCCTCCGGCCATGTCGTCGAATCAGAACAAGCCGCTGCCCTATACCAACGGCGGCAGCTCCATAGTC
CCCCCTCGACAGGCCCCGTCGGCGCCGGGCTTGCCGCGCAACATGAGCTATGCGAATACCTCCCAGCAGCCCGGC
GTCAGCCCTCAGAGGCGACCGGCCCCCAGCGAGCAGCAGCAACCGCAGCCGCAGCGTCAGCAAATGCCCGTCATG
TCCTCCGGCTACGGCTCTCAGGACGCCATGCGCGAGGAGCAGCGCAGAAAGCAACTCGAGGCCCAACGGCAGCGG
GAGGTTGACGAGATGCAGAAGCGCGAGCTGGAAGAGTACAACGCCTCGCTGCCAAAGACCAAGGTTCCTCTGGCT
CAGCAAGAGGTTGGCGGGTACGGCGGCGGTACCCCTTCGCCCCAGGCTGCCACCGATCGCTTCACACCGGCCAGA
CCGGCCCCGTCTCCGATGACGAAACAGGCCGGAACACCGGCCACCAGCCTGCGCGCCCAGAGACCCGCTCCGTCG
GCCCCCACAACGGCCGGTGCCTCGGCGCGGCCTCCCGTGTCTGCGCAGTCGATGAGCTCCCGGGATACGGCCGGC
CAGGCGGCGCGCGCGGCCGTCGGCGCCGATAGCTCCAACGGTCCCGGCTCGCTGCGGCAGCAGAACGGCAGTCAG
ACTTCCCTGGCGCGGCCGCCGCAGGCTCAGGCCCAGACGCAGGCGGCCTCGCGGTTGCCCGCACCCGTCAAGCCG
CTCAACGTGACGCCCAAGCCGAGCCAGCCTCAGCAGTCTGATAGCGTCAAGGCGGCCGAGGCGGCCCTGACGGCC
AAGCCGCCGGCCACGGAGCGCAAGCAAGACGTGCGCATGTCGACCATGTCCGAGACCGAGGTCATGGCCAAGCTC
AAGGAGGCCGTCTCCAAGGACGACCCCAACATGTCGTACTCGAAGCAGAAGAAGATCGGACAGGGCGCTTCCGGG
TCCGTGTACGTGGCCAAGATCAAGGACACGGCACAGGGCATCGCCCGCGAGGTCCTCCGTCAACAGGGGAGCAGG
GCACAGGTCGCCATCAAGCAGATGGACCTCGCTCATCAGCCAAGAAAGGAGCTGATTGTCAACGAAATCATGGTG
ATGAAGGACAGCCGGCACCGAAATATTGTCAACTTCCTCGACGCCTTCCTCCGCAACAACAATGCCGAGCTCTGG
GTCGTCATGGAGTACATGGAGGGCGGTGCGCTCACGGACGTCATCGACAACAACCCATCCATTTCGGAGGAGCAG
ATTTCGACTATTTGCCACGAGACTTGCTCGGGGCTGCAGCACCTGCACTCGCAGAGCATCATTCACCGTGACATC
AAGAGCGACAACGTCCTGCTGGACGCCCGCGGCAACGTCAAGATTACCGACTTTGGCTTCTGCGCCAAGCTCACG
GAGACGAAATCGAAGCGGGCGACGATGGTGGGGACGCCCTACTGGATGGCGCCCGAGGTGGTGAAGCAAAAGGAG
TACGGGCCCAAGGTAGACATCTGGTCGCTGGGCATCATGGCCATTGAGATGATCGAGTCGGAGCCGCCATACCTT
AACGAGGAGCCCCTCAAGGCGCTGTACCTGATTGCGACCAACGGCACGCCGAGGCTGAAGAAGCCAGAGAAGCTG
AGCAAGGAGCTCAAGGCCTTCCTCTCCGTCTGCCTCTGCGTCGACATCAAGAGTCGGGCGTCGGCGGACGAGCTG
CTGGCGCACGACTTTCTCAAGCACGGCTGTCCCCTGGCGAGCCTGGCGGATCTGCTGGCATTCAAGAAGCACGCC
AAGTGA
Transcript >Ophun1|4388
ATGCAACTAGAGCCTCGGGATGCCGTACTGGCCATCATCATCACCACCACCACTACCAGCAGGAGCAGCAACAGC
AACAACAACACCTCCTCCACCACCATCACCACCACCATCACCACCACCACCACCACCTCCTCCTCCTCCTCCGAT
CCTCCTCCGATCCTCGGATCCGCTCGCCACACGTCTCCCCCTTTCCCAACTCTCTGCGAGGCATCCTACTCATCG
GTGCCTCTGCCGCCTGCCAGCCATCACGTCGTCTCTTCCTGTCGCCGGAAGTCGGTCGACGAGGCCCGACAGCTT
CCTTGCGCCGGCTTCTCCTCGTCTGCCGAGCGCGGCTCCAAACCTCGCACGCGCGAGGCTGTCTCCCGCCACCTG
CTGCATACCTCACATCCACTCCGCTTCGCTAACGTCATCGCCAGCGTTTACTCGTCGGGCCAGTTCATGAACCCT
GGCCCTGCGCCCCGGCCTCCCGGCGACAGGCCGCGCCTGAATCTGACGCCCAGTCCAAACCTTTCCGGAAACATG
GCAAGCATGGCCATCTCCCCCAACCGAAGCACGACCACGTCGACTTACACAGGCTCCACCATCTCTCTGCCCATC
GCTCGCCAGCACTCCAACAACATCGACGGCAAGGGGGGCGTCGCTGTCAAGAAAGAAGGCTGGGCCTCGGTCAAG
GAGAGCAAGAACTTCATCCAGCCCTGGAAGTCCAAGTACCTGATACTCCGCAAGGAGTCGCTCGACTTTCACAAG
GCCGAGGGTGGCAAGGTCGCTTACACGCTCTACCTGAGGGACGTGGTCAATGTCGGCAGGGTCGAGCAGGCCGGC
ACCATATTCGAAATCAAGAGAAAGGTTGACGGCATCTCGAGCAGCCCCGGCGACGACGACGGCCAAAACAAGACG
TTGCAGATCAAGGTCAAGAGCGACGACGACCTGTACGAGTGGATCGACCTCATCTACGGCGCCTGTCCTGGCATG
GGCGGCGTCAGCAACCCGACCAACTTCTCTCACGCCGTCCACGTCGGTTTCGACCCTCAGACGGGAGAGTTTATA
GGACTCCCTCCCGAGTGGTCCAAACTCCTCAACTCGTCTGCCATCACCAAGGAAGACTATGAGCGCAACCCGCAG
GCCGTCTTCGAGGTTCTCGACTTCTATACCGATCTCGCCAAGCGAGCCGAGAACCCGACCCAATATTCGAGCCTC
ACGCCCACGCCTCCGGCCATGTCGTCGAATCAGAACAAGCCGCTGCCCTATACCAACGGCGGCAGCTCCATAGTC
CCCCCTCGACAGGCCCCGTCGGCGCCGGGCTTGCCGCGCAACATGAGCTATGCGAATACCTCCCAGCAGCCCGGC
GTCAGCCCTCAGAGGCGACCGGCCCCCAGCGAGCAGCAGCAACCGCAGCCGCAGCGTCAGCAAATGCCCGTCATG
TCCTCCGGCTACGGCTCTCAGGACGCCATGCGCGAGGAGCAGCGCAGAAAGCAACTCGAGGCCCAACGGCAGCGG
GAGGTTGACGAGATGCAGAAGCGCGAGCTGGAAGAGTACAACGCCTCGCTGCCAAAGACCAAGGTTCCTCTGGCT
CAGCAAGAGGTTGGCGGGTACGGCGGCGGTACCCCTTCGCCCCAGGCTGCCACCGATCGCTTCACACCGGCCAGA
CCGGCCCCGTCTCCGATGACGAAACAGGCCGGAACACCGGCCACCAGCCTGCGCGCCCAGAGACCCGCTCCGTCG
GCCCCCACAACGGCCGGTGCCTCGGCGCGGCCTCCCGTGTCTGCGCAGTCGATGAGCTCCCGGGATACGGCCGGC
CAGGCGGCGCGCGCGGCCGTCGGCGCCGATAGCTCCAACGGTCCCGGCTCGCTGCGGCAGCAGAACGGCAGTCAG
ACTTCCCTGGCGCGGCCGCCGCAGGCTCAGGCCCAGACGCAGGCGGCCTCGCGGTTGCCCGCACCCGTCAAGCCG
CTCAACGTGACGCCCAAGCCGAGCCAGCCTCAGCAGTCTGATAGCGTCAAGGCGGCCGAGGCGGCCCTGACGGCC
AAGCCGCCGGCCACGGAGCGCAAGCAAGACGTGCGCATGTCGACCATGTCCGAGACCGAGGTCATGGCCAAGCTC
AAGGAGGCCGTCTCCAAGGACGACCCCAACATGTCGTACTCGAAGCAGAAGAAGATCGGACAGGGCGCTTCCGGG
TCCGTGTACGTGGCCAAGATCAAGGACACGGCACAGGGCATCGCCCGCGAGGTCCTCCGTCAACAGGGGAGCAGG
GCACAGGTCGCCATCAAGCAGATGGACCTCGCTCATCAGCCAAGAAAGGAGCTGATTGTCAACGAAATCATGGTG
ATGAAGGACAGCCGGCACCGAAATATTGTCAACTTCCTCGACGCCTTCCTCCGCAACAACAATGCCGAGCTCTGG
GTCGTCATGGAGTACATGGAGGGCGGTGCGCTCACGGACGTCATCGACAACAACCCATCCATTTCGGAGGAGCAG
ATTTCGACTATTTGCCACGAGACTTGCTCGGGGCTGCAGCACCTGCACTCGCAGAGCATCATTCACCGTGACATC
AAGAGCGACAACGTCCTGCTGGACGCCCGCGGCAACGTCAAGATTACCGACTTTGGCTTCTGCGCCAAGCTCACG
GAGACGAAATCGAAGCGGGCGACGATGGTGGGGACGCCCTACTGGATGGCGCCCGAGGTGGTGAAGCAAAAGGAG
TACGGGCCCAAGGTAGACATCTGGTCGCTGGGCATCATGGCCATTGAGATGATCGAGTCGGAGCCGCCATACCTT
AACGAGGAGCCCCTCAAGGCGCTGTACCTGATTGCGACCAACGGCACGCCGAGGCTGAAGAAGCCAGAGAAGCTG
AGCAAGGAGCTCAAGGCCTTCCTCTCCGTCTGCCTCTGCGTCGACATCAAGAGTCGGGCGTCGGCGGACGAGCTG
CTGGCGCACGACTTTCTCAAGCACGGCTGTCCCCTGGCGAGCCTGGCGGATCTGCTGGCATTCAAGAAGCACGCC
AAGTGA
Gene >Ophun1|4388
ATGCAACTAGAGCCTCGGGATGCCGTACTGGCCATCATCATCACCACCACCACTACCAGCAGGAGCAGCAACAGC
AACAACAACACCTCCTCCACCACCATCACCACCACCATCACCACCACCACCACCACCTCCTCCTCCTCCTCCGAT
CCTCCTCCGATCCTCGGATCCGCTCGCCACACGTCTCCCCCTTTCCCAACTCTCTGCGAGGCATCCTACTCATCG
GTGCCTCTGCCGCCTGCCAGCCATCACGTCGTCTCTTCCTGTCGCCGGAAGTCGGTCGACGAGGCCCGACAGCTT
CCTTGCGCCGGCTTCTCCTCGTCTGCCGAGCGCGGCTCCAAACCTCGCACGCGCGAGGCTGTCTCCCGCCACCTG
CTGCATACCTCACATCCACTCCGCTTCGGTTCGACCCCGACATAGCCATATACCATGGCGCAGAATAGGCAAGTC
TCGTCCCTCGTCTGCTTTAGGCTCGAAGCGCTCTGCGTCGGGCTCCTTTTCGGGCTCCTTCGAGGCGCACATGCT
CTCTCTCTCTCTCTCCCTCTCTCTCTTCCATCAGCACCGCCACTCCGTTTCTGGCCGTCTTCCACGCCGACCTCA
CCCTGCATCTGCAATCCCTCTTCTCCCCCTACCCTTTCCCCTTCACCTTCCCCTTGCCCTTGCAGCCCTGCCCAG
AATTCCATCTCAACCCTATCGCGACCACGTGCTCATCTCAAGCTAACGTCATCGCCAGCGTTTACTCGTCGGGCC
AGTTCATGAACCCTGGCCCTGCGCCCCGGCCTCCCGGCGACAGGCCGCGCCTGAATCTGACGCCCAGTCCAAACC
TTTCCGGAAACATGGCAAGCATGGCCATCTCCCCCAACCGAAGCACGACCACGTCGACTTACACAGGCTCCACCA
TCTCTCTGCCCATCGCTCGCCAGCACTCCAACAACATCGACGGCAAGGGGGGCGTCGCTGTCAAGAAAGAAGGCT
GGGCCTCGGTCAAGGAGAGCAAGAACTTCATCCAGCCCTGGAAGTCCAAGTACCTGATACTCCGCAAGGAGTCGC
TCGACTTTCACAAGGCCGAGGGTGGCAAGGTCGCTTACACGCTCTACCTGAGGGACGTGGTCAATGTCGGCAGGG
TCGAGCAGGCCGGCACCATATTCGAAATCAAGAGAAAGGTTGACGGCATCTCGAGCAGCCCCGGCGACGACGACG
GCCAAAACAAGACGTTGCAGATCAAGGTCAAGAGCGACGACGACCTGTACGAGTGGATCGACCTCATCTACGGCG
CCTGTCCTGGCATGGGCGGCGTCAGCAACCCGACCAACTTCTCTCACGCCGTCCACGTCGGTTTCGACCCTCAGA
CGGGAGAGTTTATAGGACTCCCTCCCGAGTGGTCCAAACTCCTCAACTCGTCTGCCATCACCAAGGAAGACTATG
AGCGCAACCCGCAGGCCGTCTTCGAGGTTCTCGACTTCTATACCGATCTCGCCAAGCGAGCCGAGAACCCGACCC
AATATTCGAGCCTCACGCCCACGCCTCCGGCCATGTCGTCGAATCAGAACAAGCCGCTGCCCTATACCAACGGCG
GCAGCTCCATAGTCCCCCCTCGACAGGCCCCGTCGGCGCCGGGCTTGCCGCGCAACATGAGCTATGCGAATACCT
CCCAGCAGCCCGGCGTCAGCCCTCAGAGGCGACCGGCCCCCAGCGAGCAGCAGCAACCGCAGCCGCAGCGTCAGC
AAATGCCCGTCATGTCCTCCGGCTACGGCTCTCAGGACGCCATGCGCGAGGAGCAGCGCAGAAAGCAACTCGAGG
CCCAACGGCAGCGGGAGGTTGACGAGATGCAGAAGCGCGAGCTGGAAGAGTACAACGCCTCGCTGCCAAAGACCA
AGGTTCCTCTGGCTCAGCAAGAGGTTGGCGGGTACGGCGGCGGTACCCCTTCGCCCCAGGCTGCCACCGATCGCT
TCACACCGGCCAGACCGGCCCCGTCTCCGATGACGAAACAGGCCGGAACACCGGCCACCAGCCTGCGCGCCCAGA
GACCCGCTCCGTCGGCCCCCACAACGGCCGGTGCCTCGGCGCGGCCTCCCGTGTCTGCGCAGTCGATGAGCTCCC
GGGATACGGCCGGCCAGGCGGCGCGCGCGGCCGTCGGCGCCGATAGCTCCAACGGTCCCGGCTCGCTGCGGCAGC
AGAACGGCAGTCAGACTTCCCTGGCGCGGCCGCCGCAGGCTCAGGCCCAGACGCAGGCGGCCTCGCGGTTGCCCG
CACCCGTCAAGCCGCTCAACGTGACGCCCAAGCCGAGCCAGCCTCAGCAGTCTGATAGCGTCAAGGCGGCCGAGG
CGGCCCTGACGGCCAAGCCGCCGGCCACGGAGCGCAAGCAAGACGTGCGCATGTCGACCATGTCCGAGACCGAGG
TCATGGCCAAGCTCAAGGAGGCCGTCTCCAAGGACGACCCCAACATGTCGTACTCGAAGCAGAAGAAGATCGGAC
AGGGCGCTTCCGGGTCCGTGTACGTGGCCAAGATCAAGGACACGGCACAGGGCATCGCCCGCGAGGTCCTCCGTC
AACAGGGGAGCAGGGCACAGGTCGCCATCAAGCAGATGGACCTCGCTCATCAGCCAAGAAAGGAGCTGATTGTCA
ACGAAATCATGGTGATGAAGGACAGCCGGCACCGAAATATTGTCAACTTCCTCGACGCCTTCCTCCGCAACAACA
ATGCCGAGCTCTGGGTCGTCATGGAGTACATGGAGGGCGGTGCGCTCACGGACGTCATCGACAACAACCCATCCA
TTTCGGAGGAGCAGATTTCGACTATTTGCCACGAGGTAAGACGCGCCGATTTGTGTGAGGCCTTGATCTCGCTGA
CACTACTCCTCTCACAGACTTGCTCGGGGCTGCAGCACCTGCACTCGCAGAGCATCATTCACCGTGACATCAAGA
GCGACAACGTCCTGCTGGACGCCCGCGGCAACGTCAAGATTAGTGCGTCTCCTCCTCCATGACGGAAGGCTTGTA
TTGAACGCTCGGCTGACATGACGCAGCCGACTTTGGCTTCTGCGCCAAGCTCACGGAGACGAAATCGAAGCGGGC
GACGATGGTGGGGACGCCCTACTGGATGGCGCCCGAGGTGGTGAAGCAAAAGGAGTACGGGCCCAAGGTAGACAT
CTGGTCGCTGGGCATCATGGCCATTGAGATGATCGAGTCGGAGCCGCCATACCTTAACGAGGAGCCCCTCAAGGC
GCTGTACCTGATTGCGACCAACGGCACGCCGAGGCTGAAGAAGCCAGAGAAGCTGAGCAAGGAGCTCAAGGCCTT
CCTCTCCGTCTGCCTCTGCGTCGACATCAAGAGTCGGGCGTCGGCGGACGAGCTGCTGGCGCACGACTTTCTCAA
GCACGGCTGTCCCCTGGCGAGCCTGGCGGATCTGCTGGCATTCAAGAAGCACGCCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail