Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4384
Gene name
LocationContig_401:15177..15411
Strand-
Gene length (bp)234
Transcript length (bp)234
Coding sequence length (bp)234
Protein length (aa) 78

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13850 ERGIC_N Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC) 3.3E-15 7 65

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09895|YAI8_SCHPO Uncharacterized protein C24B11.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.08c PE=3 SV=1 1 65 5.0E-14
sp|P39727|ERV46_YEAST ER-derived vesicles protein ERV46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV46 PE=1 SV=2 4 64 8.0E-13
sp|Q6NVS2|ERGI3_XENTR Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Xenopus tropicalis GN=ergic3 PE=2 SV=1 1 65 8.0E-09
sp|Q66KH2|ERGI3_XENLA Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Xenopus laevis GN=ergic3 PE=2 SV=1 1 65 1.0E-08
sp|Q803I2|ERGI3_DANRE Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Danio rerio GN=ergic3 PE=2 SV=1 1 65 3.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4384
MPAKSRFTRLDAFTKTVDEARIRTTSGGIVTIVSLLVVLFLSWGEWAEYRRVVIRPELVVDKGRGKSYGWLVASQ
RD*
Coding >Ophun1|4384
ATGCCGGCCAAGTCACGCTTCACCAGGCTCGATGCCTTTACAAAGACGGTCGACGAGGCCCGTATCCGGACAACG
AGCGGTGGCATCGTCACCATTGTTTCGCTGCTTGTCGTCCTGTTTTTATCGTGGGGGGAATGGGCAGAGTATCGT
CGGGTGGTGATACGCCCTGAGCTGGTGGTGGACAAGGGCAGAGGCAAGTCGTACGGCTGGCTTGTTGCCTCGCAG
CGTGACTGA
Transcript >Ophun1|4384
ATGCCGGCCAAGTCACGCTTCACCAGGCTCGATGCCTTTACAAAGACGGTCGACGAGGCCCGTATCCGGACAACG
AGCGGTGGCATCGTCACCATTGTTTCGCTGCTTGTCGTCCTGTTTTTATCGTGGGGGGAATGGGCAGAGTATCGT
CGGGTGGTGATACGCCCTGAGCTGGTGGTGGACAAGGGCAGAGGCAAGTCGTACGGCTGGCTTGTTGCCTCGCAG
CGTGACTGA
Gene >Ophun1|4384
ATGCCGGCCAAGTCACGCTTCACCAGGCTCGATGCCTTTACAAAGACGGTCGACGAGGCCCGTATCCGGACAACG
AGCGGTGGCATCGTCACCATTGTTTCGCTGCTTGTCGTCCTGTTTTTATCGTGGGGGGAATGGGCAGAGTATCGT
CGGGTGGTGATACGCCCTGAGCTGGTGGTGGACAAGGGCAGAGGCAAGTCGTACGGCTGGCTTGTTGCCTCGCAG
CGTGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail