Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4381
Gene name
LocationContig_401:6820..9161
Strand-
Gene length (bp)2341
Transcript length (bp)2232
Coding sequence length (bp)2232
Protein length (aa) 744

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 2.0E+00 564 594
PF08238 Sel1 Sel1 repeat 7.6E-03 627 656
PF08238 Sel1 Sel1 repeat 9.5E-01 663 696

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38213|DSF2_YEAST Protein DSF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSF2 PE=1 SV=2 533 714 3.0E-19
sp|P87159|NIF1_SCHPO Mitosis inhibitor nif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nif1 PE=1 SV=1 526 710 6.0E-16

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3936
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7972
Ophiocordyceps australis map64 (Brazil) OphauB2|2935
Ophiocordyceps camponoti-floridani Ophcf2|04422
Ophiocordyceps camponoti-rufipedis Ophun1|4381 (this protein)
Ophiocordyceps kimflemingae Ophio5|342
Ophiocordyceps subramaniannii Hirsu2|7837

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4381
MANRPSLLDLRTDSTHSVTSTSTRPLRSPRSHVAGEVPPELSPLDAFALQSRLLAKQLQEGDGDGNRVSRLPPLT
VESPLIQQGRSDYFRSMSHDSASDAGESPDRPTSGLGLRTEIDDAFTPNDRPKSVRPRVSRIMAPPEHDAPVPPL
PRQTPRDAHGHFDFLGARRERSPSPINRHHNRMPERTSPSRQSSLLQPASRYNLSTSSSPEKAKHGSFDELGLAP
PRGPLPNRSPSTMSSSFQGDDDAASNQSGSFHLPLRTLSSASMALTNAVQSPVAGSFRRSPSVASDSSMVPRPSL
NFSRPISSMGASALDMPTRQASSDSQPSFILADESAHTPVSMHSEAFVDHQSDDVKGSLPASYIYSTFSLPRGKA
LQRSEPADGQQPHRWEQHSMSPSSTRRTPLGAPPSPPTRPSSSSIKMLPDDAASIASGATRPSLDTSKKSIDGPR
LSPAGPMTPSTDRPSTETCRRSDDAPRGRSLNSSAHDAVARRGRTPASASASAATSDSASTVRPALSTRSCAPAA
SEMSAEEHLAKGIECHENGSLKESTYHLRHAARQNNPTAMLLYALACRHGWGMRSSQKEGVAWLRKAAEYASIEI
ADDEDRAKEGKPANFLESKTRKAQFALSIYELGVSHMNGWGIEQDKSLALRCFEIAGNWGDVDALAEAGFCYAKG
VGCRKDLKKSARFYRMAEAKGMSMVGNSWIHKAKYNDDGDAASPKDKSRTKARSKSRTRAMFGLKQGS*
Coding >Ophun1|4381
ATGGCCAACCGTCCGAGCCTGCTCGACCTGCGAACCGACTCGACTCACTCGGTCACGTCGACGTCCACGAGGCCC
CTGCGATCCCCTCGCTCCCACGTTGCCGGCGAGGTGCCTCCCGAGCTGTCGCCCCTCGACGCCTTCGCCCTACAG
AGCCGGCTGCTGGCCAAGCAACTGCAGGAGGGCGACGGTGATGGCAACCGCGTCAGCCGCCTCCCGCCCCTGACT
GTTGAAAGCCCCCTCATCCAGCAGGGCCGCTCCGATTACTTTCGCTCCATGTCCCACGACTCCGCTTCTGATGCC
GGAGAATCGCCCGATCGGCCCACCTCTGGCTTAGGATTGCGCACCGAGATCGACGACGCTTTCACCCCCAACGAT
AGGCCCAAGTCGGTGCGTCCTCGCGTGAGCCGCATCATGGCGCCCCCCGAACATGACGCGCCTGTCCCGCCTCTA
CCTCGTCAAACGCCACGCGACGCCCACGGCCACTTTGACTTTCTCGGCGCCCGTCGCGAGCGCTCCCCGTCACCA
ATCAACAGGCATCACAATCGGATGCCCGAGAGGACCTCCCCCAGCAGGCAGAGCTCGCTTCTGCAGCCCGCGTCG
CGTTACAATCTATCGACCTCGAGCTCTCCCGAAAAGGCCAAACACGGCTCCTTTGATGAGCTCGGTCTCGCTCCC
CCCCGCGGTCCGCTTCCGAACCGGTCGCCGAGCACCATGTCGTCTTCCTTCCAAGGGGATGACGATGCGGCCAGC
AACCAATCCGGCTCCTTTCACCTACCGCTGCGCACGTTATCCTCGGCCAGCATGGCTTTGACCAACGCCGTGCAG
TCTCCAGTCGCCGGTTCTTTCCGGAGATCGCCGTCAGTCGCCTCTGATTCTTCCATGGTCCCCCGCCCTTCCCTC
AATTTCTCGAGACCCATCAGCAGTATGGGAGCTTCGGCCCTCGACATGCCTACCAGACAGGCCTCGTCCGACAGC
CAACCGTCCTTCATCCTGGCTGATGAGTCGGCACACACGCCAGTGAGCATGCATAGCGAAGCCTTTGTCGATCAC
CAGTCCGACGACGTCAAGGGCTCGCTTCCTGCCTCATACATCTATTCCACCTTTAGTCTTCCCAGGGGCAAGGCT
CTCCAGCGGTCCGAGCCGGCCGATGGCCAGCAGCCGCATCGATGGGAACAACACAGCATGTCGCCCAGCAGCACA
CGCCGGACGCCCTTAGGCGCCCCGCCTTCGCCACCGACACGCCCGTCGAGCTCGTCAATCAAGATGTTGCCCGAC
GACGCAGCCAGCATCGCCAGCGGCGCGACGAGGCCATCGCTCGACACCAGCAAGAAGAGCATCGACGGTCCTCGC
CTTAGTCCAGCTGGCCCCATGACTCCGAGCACCGACAGGCCATCGACCGAAACCTGTCGCCGGTCCGACGACGCC
CCGCGGGGTAGAAGTCTCAATTCGTCGGCGCACGACGCCGTTGCGCGGCGCGGGAGGACTCCGGCTTCGGCTTCG
GCTTCGGCAGCGACAAGTGACTCGGCCAGCACGGTGAGGCCGGCGCTTTCCACCCGCTCGTGCGCCCCTGCGGCC
TCGGAAATGTCGGCGGAAGAGCACTTGGCCAAGGGCATCGAGTGCCACGAGAACGGTTCCCTAAAGGAGTCGACA
TACCACCTCCGGCACGCTGCGCGGCAGAACAATCCCACGGCCATGTTGCTATATGCCCTCGCCTGCCGCCATGGC
TGGGGCATGCGCTCGAGCCAGAAGGAGGGCGTCGCGTGGCTACGCAAGGCTGCCGAGTATGCCAGCATCGAAATT
GCCGACGACGAAGACCGGGCCAAGGAGGGAAAGCCGGCCAACTTTCTCGAGAGCAAGACTCGCAAGGCTCAGTTT
GCGCTCAGCATATACGAGCTCGGCGTCAGCCACATGAACGGCTGGGGTATCGAGCAGGACAAGTCGCTCGCACTG
CGGTGTTTCGAGATCGCCGGCAACTGGGGTGACGTCGACGCGCTGGCCGAGGCTGGCTTCTGTTATGCCAAGGGC
GTTGGCTGCAGAAAGGACCTCAAGAAGAGTGCTCGCTTCTACCGAATGGCCGAGGCCAAGGGGATGAGCATGGTT
GGAAACAGCTGGATCCACAAGGCGAAATACAACGACGACGGAGACGCCGCTTCACCTAAAGACAAGTCCAGGACC
AAGGCCCGGAGCAAGTCCCGCACCCGAGCCATGTTCGGCTTGAAACAGGGCTCATGA
Transcript >Ophun1|4381
ATGGCCAACCGTCCGAGCCTGCTCGACCTGCGAACCGACTCGACTCACTCGGTCACGTCGACGTCCACGAGGCCC
CTGCGATCCCCTCGCTCCCACGTTGCCGGCGAGGTGCCTCCCGAGCTGTCGCCCCTCGACGCCTTCGCCCTACAG
AGCCGGCTGCTGGCCAAGCAACTGCAGGAGGGCGACGGTGATGGCAACCGCGTCAGCCGCCTCCCGCCCCTGACT
GTTGAAAGCCCCCTCATCCAGCAGGGCCGCTCCGATTACTTTCGCTCCATGTCCCACGACTCCGCTTCTGATGCC
GGAGAATCGCCCGATCGGCCCACCTCTGGCTTAGGATTGCGCACCGAGATCGACGACGCTTTCACCCCCAACGAT
AGGCCCAAGTCGGTGCGTCCTCGCGTGAGCCGCATCATGGCGCCCCCCGAACATGACGCGCCTGTCCCGCCTCTA
CCTCGTCAAACGCCACGCGACGCCCACGGCCACTTTGACTTTCTCGGCGCCCGTCGCGAGCGCTCCCCGTCACCA
ATCAACAGGCATCACAATCGGATGCCCGAGAGGACCTCCCCCAGCAGGCAGAGCTCGCTTCTGCAGCCCGCGTCG
CGTTACAATCTATCGACCTCGAGCTCTCCCGAAAAGGCCAAACACGGCTCCTTTGATGAGCTCGGTCTCGCTCCC
CCCCGCGGTCCGCTTCCGAACCGGTCGCCGAGCACCATGTCGTCTTCCTTCCAAGGGGATGACGATGCGGCCAGC
AACCAATCCGGCTCCTTTCACCTACCGCTGCGCACGTTATCCTCGGCCAGCATGGCTTTGACCAACGCCGTGCAG
TCTCCAGTCGCCGGTTCTTTCCGGAGATCGCCGTCAGTCGCCTCTGATTCTTCCATGGTCCCCCGCCCTTCCCTC
AATTTCTCGAGACCCATCAGCAGTATGGGAGCTTCGGCCCTCGACATGCCTACCAGACAGGCCTCGTCCGACAGC
CAACCGTCCTTCATCCTGGCTGATGAGTCGGCACACACGCCAGTGAGCATGCATAGCGAAGCCTTTGTCGATCAC
CAGTCCGACGACGTCAAGGGCTCGCTTCCTGCCTCATACATCTATTCCACCTTTAGTCTTCCCAGGGGCAAGGCT
CTCCAGCGGTCCGAGCCGGCCGATGGCCAGCAGCCGCATCGATGGGAACAACACAGCATGTCGCCCAGCAGCACA
CGCCGGACGCCCTTAGGCGCCCCGCCTTCGCCACCGACACGCCCGTCGAGCTCGTCAATCAAGATGTTGCCCGAC
GACGCAGCCAGCATCGCCAGCGGCGCGACGAGGCCATCGCTCGACACCAGCAAGAAGAGCATCGACGGTCCTCGC
CTTAGTCCAGCTGGCCCCATGACTCCGAGCACCGACAGGCCATCGACCGAAACCTGTCGCCGGTCCGACGACGCC
CCGCGGGGTAGAAGTCTCAATTCGTCGGCGCACGACGCCGTTGCGCGGCGCGGGAGGACTCCGGCTTCGGCTTCG
GCTTCGGCAGCGACAAGTGACTCGGCCAGCACGGTGAGGCCGGCGCTTTCCACCCGCTCGTGCGCCCCTGCGGCC
TCGGAAATGTCGGCGGAAGAGCACTTGGCCAAGGGCATCGAGTGCCACGAGAACGGTTCCCTAAAGGAGTCGACA
TACCACCTCCGGCACGCTGCGCGGCAGAACAATCCCACGGCCATGTTGCTATATGCCCTCGCCTGCCGCCATGGC
TGGGGCATGCGCTCGAGCCAGAAGGAGGGCGTCGCGTGGCTACGCAAGGCTGCCGAGTATGCCAGCATCGAAATT
GCCGACGACGAAGACCGGGCCAAGGAGGGAAAGCCGGCCAACTTTCTCGAGAGCAAGACTCGCAAGGCTCAGTTT
GCGCTCAGCATATACGAGCTCGGCGTCAGCCACATGAACGGCTGGGGTATCGAGCAGGACAAGTCGCTCGCACTG
CGGTGTTTCGAGATCGCCGGCAACTGGGGTGACGTCGACGCGCTGGCCGAGGCTGGCTTCTGTTATGCCAAGGGC
GTTGGCTGCAGAAAGGACCTCAAGAAGAGTGCTCGCTTCTACCGAATGGCCGAGGCCAAGGGGATGAGCATGGTT
GGAAACAGCTGGATCCACAAGGCGAAATACAACGACGACGGAGACGCCGCTTCACCTAAAGACAAGTCCAGGACC
AAGGCCCGGAGCAAGTCCCGCACCCGAGCCATGTTCGGCTTGAAACAGGGCTCATGA
Gene >Ophun1|4381
ATGGCCAACCGTCCGAGCCTGCTCGACCTGCGAACCGACTCGACTCACTCGGTCACGTCGACGTCCACGAGGCCC
CTGCGATCCCCTCGCTCCCACGTTGCCGGCGAGGTGCCTCCCGAGCTGTCGCCCCTCGACGCCTTCGCCCTACAG
AGCCGGCTGCTGGCCAAGCAACTGCAGGAGGGCGACGGTGATGGCAACCGCGTCAGCCGCCTCCCGCCCCTGACT
GTTGAAAGCCCCCTCATCCAGCAGGGCCGCTCCGATTACTTTCGCTCCATGTCCCACGACTCCGCTTCTGATGCC
GGAGAATCGCCCGATCGGCCCACCTCTGGCTTAGGATTGCGCACCGAGATCGACGACGCTTTCACCCCCAACGAT
AGGCCCAAGTCGGTGCGTCCTCGCGTGAGCCGCATCATGGCGCCCCCCGAACATGACGCGCCTGTCCCGCCTCTA
CCTCGTCAAACGCCACGCGACGCCCACGGCCACTTTGACTTTCTCGGCGCCCGTCGCGAGCGCTCCCCGTCACCA
ATCAACAGGCATCACAATCGGATGCCCGAGAGGACCTCCCCCAGCAGGCAGAGCTCGCTTCTGCAGCCCGCGTCG
CGTTACAATCTATCGACCTCGAGCTCTCCCGAAAAGGCCAAACACGGCTCCTTTGATGAGCTCGGTCTCGCTCCC
CCCCGCGGTCCGCTTCCGAACCGGTCGCCGAGCACCATGTCGTCTTCCTTCCAAGGGGATGACGATGCGGCCAGC
AACCAATCCGGCTCCTTTCACCTACCGCTGCGCACGTTATCCTCGGCCAGCATGGCTTTGACCAACGCCGTGCAG
TCTCCAGTCGCCGGTTCTTTCCGGAGATCGCCGTCAGTCGCCTCTGATTCTTCCATGGTCCCCCGCCCTTCCCTC
AATTTCTCGAGACCCATCAGCAGTATGGGAGCTTCGGCCCTCGACATGCCTACCAGACAGGCCTCGTCCGACAGC
CAACCGTCCTTCATCCTGGCTGATGAGTCGGCACACACGCCAGTGAGCATGCATAGCGAAGCCTTTGTCGATCAC
CAGTCCGACGACGTCAAGGGCTCGCTTCCTGCCTCATACATCTATTCCACCTTTAGTCTTCCCAGGGGCAAGGCT
CTCCAGCGGTCCGAGCCGGCCGATGGCCAGCAGCCGCATCGATGGGAACAACACAGCATGTCGCCCAGCAGCACA
CGCCGGACGCCCTTAGGCGCCCCGCCTTCGCCACCGACACGCCCGTCGAGCTCGTCAATCAAGATGTTGCCCGAC
GACGCAGCCAGCATCGCCAGCGGCGCGACGAGGCCATCGCTCGACACCAGCAAGAAGAGCATCGACGGTCCTCGC
CTTAGTCCAGCTGGCCCCATGACTCCGAGCACCGACAGGCCATCGACCGAAACCTGTCGCCGGTCCGACGACGCC
CCGCGGGGTAGAAGTCTCAATTCGTCGGCGCACGACGCCGTTGCGCGGCGCGGGAGGACTCCGGCTTCGGCTTCG
GCTTCGGCAGCGACAAGTGACTCGGCCAGCACGGTGAGGCCGGCGCTTTCCACCCGCTCGTGCGCCCCTGCGGCC
TCGGAAATGTCGGCGGAAGAGCACTTGGCCAAGGGCATCGAGTGCCACGAGAACGGTTCCCTAAAGGAGTCGACA
TACCACCTCCGGCACGCTGCGCGGCAGAACAATCCCACGGCCATGTTGCTATATGCCCTCGCCTGCCGCCATGGC
TGGGGCATGCGCTCGAGCCAGAAGGAGGGCGTCGCGTGGCTACGCAAGGCTGCCGAGTATGCCAGCATCGAAATT
GCCGACGACGAAGACCGGGCCAAGGAGGGAAAGCCGGCCAACTTTCTCGAGAGCAAGACTCGCAAGGCTCAGTTT
GCGCTCAGCATATACGAGCTCGGCGTCAGCCACATGAACGGCTGGGGTATCGAGCAGGACAAGTCGCTCGCACTG
CGGTGTTTCGAGATCGCCGGCAGTGAGTATTCTCTAATGGCAGTTAAAGATTGCCCTGGCTGACGGATAATGCTC
AGACTGGGGTGACGTCGACGCGCTGGCCGAGGCTGGCTTCTGTTATGCCAAGGGCGTTGGCTGCAGAAAGGACCT
CAAGAAGAGTGCTCGCTTCTACCGAATGGCCGAGGCCAAGGGGATGAGCATGGTTGGAAACAGCTGGTAAGCCTC
TGTTCATCCCGTCTTGCACGGCATGGACGCTTACATGGGCTACAGGATCCACAAGGCGAAATACAACGACGACGG
AGACGCCGCTTCACCTAAAGACAAGTCCAGGACCAAGGCCCGGAGCAAGTCCCGCACCCGAGCCATGTTCGGCTT
GAAACAGGGCTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail